BLASTX 2.2.5 [Nov-16-2002]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pat.pk0035.e4.f
         (657 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF
           1,284,757 sequences; 410,684,102 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P19121|ALBU_CHICK  Serum albumin precursor >gi|476378|pir...   147   7e-063
ref|XP_132149.1|  albumin 1 [Mus musculus] >gi|5915682|sp|P0...    84   1e-015
sp|P49065|ALBU_RABIT  Serum albumin precursor >gi|642019|gb|...    82   4e-015
sp|O35090|ALBU_MERUN  Serum albumin precursor >gi|7441763|pi...    78   1e-013
gb|AAH35969.1|  similar to serum albumin precursor [Homo sap...    77   1e-013
gb|AAF01333.1|AF190168_1  serum albumin precursor [Homo sapi...    77   1e-013
emb|CAA23753.1|  reading frame HSA [Homo sapiens]                  77   1e-013
emb|CAA23754.1|  serum albumin [Homo sapiens]                      77   1e-013
gb|AAN17825.1|  serum albumin [Homo sapiens]                       77   1e-013
ref|NP_000468.1|  albumin precursor; PRO0883 protein [Homo s...    77   1e-013
>sp|P19121|ALBU_CHICK Serum albumin precursor
 pir||ABCHS serum albumin precursor - chicken
 emb|CAA43098.1| preproalbumin (serum albumin) [Gallus gallus]
          Length = 615

 Score =  147 bits (370), Expect(3) = 7e-063
 Identities = 72/73 (98%), Positives = 73/73 (99%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           EIA+RYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP
Sbjct: 33  EIAHRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 92

Query: 291 LPSIILDEICQVE 329
           LPSIILDEICQVE
Sbjct: 93  LPSIILDEICQVE 105

 Score = 70.5 bits (171), Expect(3) = 7e-063
 Identities = 51/109 (46%), Positives = 64/109 (57%), Gaps = 9/109 (8%)
 Frame = +2

Query: 329 KLRDSYGAMADCCNKADPERNECSCHLKFXN-RLVKAY-KDSSDVICXN-TGHRVSF-WE 496
           KLRDSYGAMADCC+KADPERNEC    K      V+ Y + +SDVIC     +RVSF   
Sbjct: 106 KLRDSYGAMADCCSKADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGH 165

Query: 497 FIY-LLKKHPFVCLQS*L-L*FDSTQALQK*SCC*HXE---CMEKARIV 628
           FIY + ++HPF+   + L    D   ALQ  SCC   +   C++   IV
Sbjct: 166 FIYSVARRHPFLYAPAILSFAVDFEHALQ--SCCKESDVGACLDTKEIV 212

 Score = 66.6 bits (161), Expect(3) = 7e-063
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKS 109
           MKWVTLISFIFLFSSATSRNLQRFARDAEHKS
Sbjct: 1   MKWVTLISFIFLFSSATSRNLQRFARDAEHKS 32
>ref|XP_132149.1| albumin 1 [Mus musculus]
 sp|P07724|ALBU_MOUSE Serum albumin precursor
 emb|CAA09617.1| serum albumin [Mus musculus]
 dbj|BAB26650.1| unnamed protein product [Mus musculus]
 gb|AAH24643.1| Similar to albumin [Mus musculus]
 emb|CAD29888.1| serum albumin [Mus musculus]
          Length = 608

 Score = 84.3 bits (207), Expect = 1e-015
 Identities = 37/79 (46%), Positives = 57/79 (71%)
 Frame = +3

Query: 96  QSTRVEIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAP 275
           ++ + EIA+RYNDL E+ FK + +I F+QYLQ+CSY+  +KLV++V D A+ CVA+E A 
Sbjct: 25  EAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAA 84

Query: 276 ECSKPLPSIILDEICQVEN 332
            C K L ++  D++C + N
Sbjct: 85  NCDKSLHTLFGDKLCAIPN 103
>sp|P49065|ALBU_RABIT Serum albumin precursor
 gb|AAB58347.1| serum albumin precursor
          Length = 608

 Score = 82.4 bits (202), Expect = 4e-015
 Identities = 39/75 (52%), Positives = 54/75 (72%)
 Frame = +3

Query: 96  QSTRVEIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAP 275
           ++ + EIA+R+ND+ EE F  + +ITF+QYLQ+C YE  +KLVK+V DLA+ CVA+E A 
Sbjct: 25  EAHKSEIAHRFNDVGEEHFIGLVLITFSQYLQKCPYEEHAKLVKEVTDLAKACVADESAA 84

Query: 276 ECSKPLPSIILDEIC 320
            C K L  I  D+IC
Sbjct: 85  NCDKSLHDIFGDKIC 99

 Score = 64.3 bits (155), Expect = 1e-009
 Identities = 59/181 (32%), Positives = 83/181 (45%), Gaps = 10/181 (5%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRNI*G------SCHDHI 175
           MKWVT IS +FLFSSA SR +  F R+A HKS            +  G      S +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRREA-HKSEIAHRFNDVGEEHFIGLVLITFSQYLQK 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPSGKLRDSYGAM 355
           CP      L + V      C +     +   C   L    F      LPS  LRD+YG +
Sbjct: 58  CPYEEHAKLVKEVTDLAKACVADESAAN---CDKSLHDI-FGDKICALPS--LRDTYGDV 111

Query: 356 ADCCNKADPERNECSCHLKFXNRLVKAY-KDSSDVIC--XNTGHRVSFWEFIY-LLKKHP 523
           ADCC K +PERNEC  H K     +  + +  +DV+C   +   +  F  ++Y + ++HP
Sbjct: 112 ADCCEKKEPERNECFLHHKDDKPDLPPFARPEADVLCKAFHDDEKAFFGHYLYEVARRHP 171

Query: 524 F 526
           +
Sbjct: 172 Y 172
>sp|O35090|ALBU_MERUN Serum albumin precursor
 pir||JC5838 albumin - Mongolian jird
 dbj|BAA21765.1| albumin [Meriones unguiculatus]
          Length = 609

 Score = 77.8 bits (190), Expect = 1e-013
 Identities = 35/74 (47%), Positives = 49/74 (65%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           EIA+RY DL E+ FK + + TF+QYLQ+CSYE   KLV++V D A  C  +E A  C K 
Sbjct: 31  EIAHRYKDLGEKYFKGLVLYTFSQYLQKCSYEEHVKLVREVTDFASNCAKDESAENCDKS 90

Query: 291 LPSIILDEICQVEN 332
           L ++  D++C + N
Sbjct: 91  LHTLFGDKLCSLPN 104

 Score = 51.6 bits (122), Expect = 8e-006
 Identities = 55/181 (30%), Positives = 74/181 (40%), Gaps = 10/181 (5%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRNI*G------SCHDHI 175
           MKWVT +  +F+  SA SR +  F RDA HKS      +    +   G      S +   
Sbjct: 1   MKWVTFLLLLFVSGSAFSRGV--FRRDAAHKSEIAHRYKDLGEKYFKGLVLYTFSQYLQK 58

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPSGKLRDSYGAM 355
           C     V L R V      C    K  S   C   L T  F     +LP+    + Y  M
Sbjct: 59  CSYEEHVKLVREVTDFASNC---AKDESAENCDKSLHTL-FGDKLCSLPN--FGEKYAEM 112

Query: 356 ADCCNKADPERNECSCHLKFXNRLVKAYKDSS-DVICXNTGHRVSFWEFIYL---LKKHP 523
           ADCC K +PERNEC    K  N  +  +K +  D +C         +   YL    ++HP
Sbjct: 113 ADCCAKQEPERNECFLQHKDDNPQLPPFKRAEPDAMCTAFQENAEAFMGHYLHEVARRHP 172

Query: 524 F 526
           +
Sbjct: 173 Y 173
>gb|AAH35969.1| similar to serum albumin precursor [Homo sapiens]
          Length = 396

 Score = 77.4 bits (189), Expect = 1e-013
 Identities = 35/72 (48%), Positives = 50/72 (68%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           E+A+R+ DL EE FKA+ +I FAQYLQ+C +E   KLV +V + A+ CVA+E A  C K 
Sbjct: 30  EVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS 89

Query: 291 LPSIILDEICQV 326
           L ++  D++C V
Sbjct: 90  LHTLFGDKLCTV 101

 Score = 60.8 bits (146), Expect = 1e-008
 Identities = 58/158 (36%), Positives = 71/158 (44%), Gaps = 8/158 (5%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRN------I*GSCHDHI 175
           MKWVT IS +FLFSSA SR +  F RDA HKS      +     N      I  + +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRRDA-HKSEVAHRFKDLGEENFKALVLIAFAQYLQQ 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPS-GKLRDSYGA 352
           CP    V L   V      C +     S   C   L T      G  L +   LR++YG 
Sbjct: 58  CPFEDHVKLVNEVTEFAKTCVADE---SAENCDKSLHTLF----GDKLCTVATLRETYGE 110

Query: 353 MADCCNKADPERNECSCHLKFXN-RLVKAYKDSSDVIC 463
           MADCC K +PERNEC    K  N  L +  +   DV+C
Sbjct: 111 MADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMC 148
>gb|AAF01333.1|AF190168_1 serum albumin precursor [Homo sapiens]
          Length = 609

 Score = 77.4 bits (189), Expect = 1e-013
 Identities = 35/72 (48%), Positives = 50/72 (68%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           E+A+R+ DL EE FKA+ +I FAQYLQ+C +E   KLV +V + A+ CVA+E A  C K 
Sbjct: 30  EVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS 89

Query: 291 LPSIILDEICQV 326
           L ++  D++C V
Sbjct: 90  LHTLFGDKLCTV 101

 Score = 60.8 bits (146), Expect = 1e-008
 Identities = 60/182 (32%), Positives = 81/182 (43%), Gaps = 11/182 (6%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRN------I*GSCHDHI 175
           MKWVT IS +FLFSSA SR +  F RDA HKS      +     N      I  + +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRRDA-HKSEVAHRFKDLGEENFKALVLIAFAQYLQQ 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPS-GKLRDSYGA 352
           CP    V L   V      C +     S   C   L T      G  L +   LR++YG 
Sbjct: 58  CPFEDHVKLVNEVTEFAKTCVADE---SAENCDKSLHTLF----GDKLCTVATLRETYGE 110

Query: 353 MADCCNKADPERNECSCHLKFXN-RLVKAYKDSSDVICX--NTGHRVSFWEFIY-LLKKH 520
           MADCC K +PE NEC    K  N  L +  +   DV+C   +        +++Y + ++H
Sbjct: 111 MADCCAKQEPESNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRH 170

Query: 521 PF 526
           P+
Sbjct: 171 PY 172
>emb|CAA23753.1| reading frame HSA [Homo sapiens]
          Length = 609

 Score = 77.4 bits (189), Expect = 1e-013
 Identities = 35/72 (48%), Positives = 50/72 (68%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           E+A+R+ DL EE FKA+ +I FAQYLQ+C +E   KLV +V + A+ CVA+E A  C K 
Sbjct: 30  EVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS 89

Query: 291 LPSIILDEICQV 326
           L ++  D++C V
Sbjct: 90  LHTLFGDKLCTV 101

 Score = 60.5 bits (145), Expect = 2e-008
 Identities = 60/182 (32%), Positives = 81/182 (43%), Gaps = 11/182 (6%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRN------I*GSCHDHI 175
           MKWVT IS +FLFSSA SR +  F RDA HKS      +     N      I  + +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRRDA-HKSEVAHRFKDLGEENFKALVLIAFAQYLQQ 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPS-GKLRDSYGA 352
           CP    V L   V      C +     S   C   L T      G  L +   LR++YG 
Sbjct: 58  CPFEDHVKLVNEVTEFAKTCVADE---SAENCDKSLHTLF----GDKLCTVATLRETYGE 110

Query: 353 MADCCNKADPERNECSCHLKFXN-RLVKAYKDSSDVICX--NTGHRVSFWEFIY-LLKKH 520
           MADCC K +P RNEC    K  N  L +  +   DV+C   +        +++Y + ++H
Sbjct: 111 MADCCAKQEPGRNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRH 170

Query: 521 PF 526
           P+
Sbjct: 171 PY 172
>emb|CAA23754.1| serum albumin [Homo sapiens]
          Length = 609

 Score = 77.4 bits (189), Expect = 1e-013
 Identities = 35/72 (48%), Positives = 50/72 (68%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           E+A+R+ DL EE FKA+ +I FAQYLQ+C +E   KLV +V + A+ CVA+E A  C K 
Sbjct: 30  EVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS 89

Query: 291 LPSIILDEICQV 326
           L ++  D++C V
Sbjct: 90  LHTLFGDKLCTV 101

 Score = 63.2 bits (152), Expect = 3e-009
 Identities = 61/182 (33%), Positives = 82/182 (44%), Gaps = 11/182 (6%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRN------I*GSCHDHI 175
           MKWVT IS +FLFSSA SR +  F RDA HKS      +     N      I  + +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRRDA-HKSEVAHRFKDLGEENFKALVLIAFAQYLQQ 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPS-GKLRDSYGA 352
           CP    V L   V      C +     S   C   L T      G  L +   LR++YG 
Sbjct: 58  CPFEDHVKLVNEVTEFAKTCVADE---SAENCDKSLHTLF----GDKLCTVATLRETYGE 110

Query: 353 MADCCNKADPERNECSCHLKFXN-RLVKAYKDSSDVICX--NTGHRVSFWEFIY-LLKKH 520
           MADCC K +PERNEC    K  N  L +  +   DV+C   +        +++Y + ++H
Sbjct: 111 MADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRH 170

Query: 521 PF 526
           P+
Sbjct: 171 PY 172
>gb|AAN17825.1| serum albumin [Homo sapiens]
          Length = 609

 Score = 77.4 bits (189), Expect = 1e-013
 Identities = 35/72 (48%), Positives = 50/72 (68%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           E+A+R+ DL EE FKA+ +I FAQYLQ+C +E   KLV +V + A+ CVA+E A  C K 
Sbjct: 30  EVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS 89

Query: 291 LPSIILDEICQV 326
           L ++  D++C V
Sbjct: 90  LHTLFGDKLCTV 101

 Score = 63.2 bits (152), Expect = 3e-009
 Identities = 61/182 (33%), Positives = 82/182 (44%), Gaps = 11/182 (6%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRN------I*GSCHDHI 175
           MKWVT IS +FLFSSA SR +  F RDA HKS      +     N      I  + +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRRDA-HKSEVAHRFKDLGEENFKALVLIAFAQYLQQ 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPS-GKLRDSYGA 352
           CP    V L   V      C +     S   C   L T      G  L +   LR++YG 
Sbjct: 58  CPFEDHVKLVNEVTEFAKTCVADE---SAENCDKSLHTLF----GDKLCTVATLRETYGE 110

Query: 353 MADCCNKADPERNECSCHLKFXN-RLVKAYKDSSDVICX--NTGHRVSFWEFIY-LLKKH 520
           MADCC K +PERNEC    K  N  L +  +   DV+C   +        +++Y + ++H
Sbjct: 111 MADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRH 170

Query: 521 PF 526
           P+
Sbjct: 171 PY 172
>ref|NP_000468.1| albumin precursor; PRO0883 protein [Homo sapiens]
 sp|P02768|ALBU_HUMAN Serum albumin precursor
 pir||ABHUS serum albumin precursor [validated] - human
 gb|AAA98797.1| albumin
 gb|AAF69594.1|AF119917_2 PRO0903 [Homo sapiens]
 gb|AAH34023.1| albumin [Homo sapiens]
 gb|AAH36003.1| similar to serum albumin [Homo sapiens]
          Length = 609

 Score = 77.4 bits (189), Expect = 1e-013
 Identities = 35/72 (48%), Positives = 50/72 (68%)
 Frame = +3

Query: 111 EIANRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKP 290
           E+A+R+ DL EE FKA+ +I FAQYLQ+C +E   KLV +V + A+ CVA+E A  C K 
Sbjct: 30  EVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS 89

Query: 291 LPSIILDEICQV 326
           L ++  D++C V
Sbjct: 90  LHTLFGDKLCTV 101

 Score = 63.2 bits (152), Expect = 3e-009
 Identities = 61/182 (33%), Positives = 82/182 (44%), Gaps = 11/182 (6%)
 Frame = +2

Query: 14  MKWVTLISFIFLFSSATSRNLQRFARDAEHKSGNCQSLQ*FERRN------I*GSCHDHI 175
           MKWVT IS +FLFSSA SR +  F RDA HKS      +     N      I  + +   
Sbjct: 1   MKWVTFISLLFLFSSAYSRGV--FRRDA-HKSEVAHRFKDLGEENFKALVLIAFAQYLQQ 57

Query: 176 CPVSPEVLL*RTV*ACEGCC*SGTKMCSQ*RCS*MLKTTAFHYPG*NLPS-GKLRDSYGA 352
           CP    V L   V      C +     S   C   L T      G  L +   LR++YG 
Sbjct: 58  CPFEDHVKLVNEVTEFAKTCVADE---SAENCDKSLHTLF----GDKLCTVATLRETYGE 110

Query: 353 MADCCNKADPERNECSCHLKFXN-RLVKAYKDSSDVICX--NTGHRVSFWEFIY-LLKKH 520
           MADCC K +PERNEC    K  N  L +  +   DV+C   +        +++Y + ++H
Sbjct: 111 MADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRH 170

Query: 521 PF 526
           P+
Sbjct: 171 PY 172
  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Dec 31, 2002  2:27 PM
  Number of letters in database: 410,684,102
  Number of sequences in database:  1,284,757
  
Lambda     K      H
   0.318    0.135    0.000 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 486,457,983
Number of Sequences: 1284757
Number of extensions: 9776602
Number of successful extensions: 25053
Number of sequences better than 1.0e-05: 64
Number of HSP's better than  0.0 without gapping: 24207
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25041
length of database: 410,684,102
effective HSP length: 118
effective length of database: 259,082,776
effective search space used: 25908277600
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)