TBLASTN 2.2.2 [Dec-14-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 
         (608 letters)

Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS,
GSS, or phase 0, 1 or 2 HTGS sequences)
           1,166,659 sequences; 602,804,554 total letters

Searching... please wait.. done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|U66463.1|GGU66463  Gallus gallus membrane type-matrix met...  1187  0.0
ref|NM_005941.2|  Homo sapiens matrix metalloproteinase 16 (...  1100  0.0
dbj|D83646.1|HUMMETALL  Homo sapiens mRNA for metalloprotein...  1100  0.0
dbj|D85511.1|D85511  Homo sapiens mRNA for MT3-MMP, complete...  1100  0.0
ref|NM_019724.1|  Mus musculus matrix metalloproteinase 16 (...  1099  0.0
dbj|AB021228.1|AB021228  Mus musculus mRNA for membrane-type...  1099  0.0
dbj|AB009303.1|AB009303  Homo sapiens mRNA for membrane-type...  1098  0.0
gb|AF282844.1|AF282844  Mus musculus matrix metalloproteinas...  1097  0.0
dbj|D85509.1|D85509  Rattus rattus mRNA for MT3-MMP, complet...  1096  0.0
ref|NM_080776.1|  Rattus norvegicus matrix metalloproteinase...   978  0.0
dbj|D63886.1|D63886  Rattus sp. mRNA for MT3-MMP-del, comple...   978  0.0
gb|AF244994.1|AF244994  Scyliorhinus torazame membrane type-...   893  0.0
ref|NM_006690.2|  Homo sapiens matrix metalloproteinase 24 (...   765  0.0
dbj|AB021227.1|AB021227  Homo sapiens mRNA for membrane-type...   765  0.0
gb|AF131284.1|AF131284  Homo sapiens membrane type 5 matrix ...   765  0.0
ref|XM_047216.1|  Homo sapiens matrix metalloproteinase 24 (...   765  0.0
dbj|AB021226.1|AB021226  Mus musculus mRNA for membrane-type...   763  0.0
ref|NM_031757.1|  Rattus norvegicus matrix metalloproteinase...   762  0.0
dbj|AB023659.1|AB023659  Rattus norvegicus mt5-mmp mRNA for ...   762  0.0
ref|NM_010808.1|  Mus musculus matrix metalloproteinase 24 (...   753  0.0
emb|AJ010262.1|MMU010262  Mus musculus mRNA for membrane-typ...   753  0.0
ref|NM_022564.1|  Homo sapiens matrix metalloproteinase 16 (...   726  0.0
dbj|D83647.1|HUMMETALLA  Homo sapiens mRNA for metalloprotei...   726  0.0
dbj|AB047651.1|AB047651  Oryzias latipes MT5-MMP mRNA for me...   707  0.0
ref|NM_031056.1|  Rattus norvegicus matrix metalloproteinase...   630  e-178
emb|X91785.1|RNMTMMPGN  R.norvegicus mRNA for membrane-type ...   630  e-178
gb|U54984.1|MMU54984  Mus musculus membrane-type matrix meta...   629  e-178
ref|NM_004995.2|  Homo sapiens matrix metalloproteinase 14 (...   627  e-177
gb|U41078.1|HSU41078  Human membrane-type matrix metalloprot...   627  e-177
emb|Z48481.1|HSMMPM1  H.sapiens mRNA for membrane-type matri...   627  e-177
emb|X83535.1|HSMTMMP29  Homo sapiens mRNA for membrane-type ...   627  e-177
dbj|AB010921.1|AB010921  Capra hircus MT1MMP mRNA for Membra...   627  e-177
emb|X83537.1|RNMTMMP  Rattus norvegicus mRNA for membrane-ty...   626  e-177
dbj|D26512.1|HUMMTMMP  Human mRNA for membrane type matrix m...   626  e-177
emb|X90925.1|HSMTMMPPR  H.sapiens mRNA for MT-MMP protein         625  e-177
gb|AF067419.1|AF067419  Sus scrofa membrane-type 1 matrix me...   622  e-176
gb|AF290429.1|AF290429  Bos taurus membrane-type matrix meta...   622  e-176
gb|AF306662.2|AF306662  Cricetulus griseus matrix metallopro...   621  e-176
gb|BC006412.1|BC006412  Homo sapiens, matrix metalloproteina...   617  e-174
ref|NM_002428.1|  Homo sapiens matrix metalloproteinase 15 (...   617  e-174
emb|Z48482.1|HSMMPM2  H.sapiens mRNA for membrane-type matri...   617  e-174
ref|NM_008609.1|  Mus musculus matrix metalloproteinase 15 (...   615  e-174
dbj|D86332.1|D86332  Mus musculus mRNA for membrane type-2 m...   615  e-174
gb|U73940.1|OCU73940  Oryctolagus cuniculus membane-type 1 m...   614  e-174
ref|NM_008608.1|  Mus musculus matrix metalloproteinase 14 (...   614  e-174
emb|X83536.2|MMMTMMP  Mus musculus mRNA for membrane-type ma...   614  e-174
gb|U83918.1|OCU83918  Oryctolagus cuniculus membrane type 1 ...   611  e-173
dbj|AB047650.1|AB047650  Oryzias latipes MT5-MMP-del mRNA fo...   607  e-172
dbj|D86331.1|D86331  Human MT2-MMP gene for matrix metallopr...   572  e-161
dbj|D85510.1|D85510  Homo sapiens mRNA for SMCP-2, partial cds    502  e-140
gb|AF267160.1|AF267160  Ovis aries membrane type-1 metallopr...   335  8e-90
emb|AJ010731.1|MAJ10731  Mus musculus mRNA for membrane-type...   318  1e-84
ref|NM_011846.1|  Mus musculus matrix metalloproteinase 17 (...   318  1e-84
dbj|AB021224.1|AB021224  Mus musculus mRNA for membrane-type...   318  1e-84
gb|AF185270.1|AF185270  Homo sapiens leukolysin (MMP25) mRNA...   317  2e-84
gb|AF145442.2|AF145442  Homo sapiens leukolysin mRNA, comple...   317  2e-84
ref|NM_022468.2|  Homo sapiens matrix metalloproteinase 25 (...   317  2e-84
emb|AJ272137.1|HSA272137  Homo sapiens mRNA for membrane typ...   317  2e-84
emb|AJ239053.1|HSA239053  Homo sapiens mRNA for matrix metal...   317  2e-84
ref|NM_022718.1|  Homo sapiens matrix metalloproteinase 25 (...   317  2e-84
dbj|AB042328.1|AB042328  Homo sapiens mt6-mmp mRNA for membr...   313  2e-83
emb|X89576.1|HSMMP17  Homo sapiens mRNA for putative MT2-MMP...   304  1e-80
ref|NM_016155.2|  Homo sapiens matrix metalloproteinase 17 (...   304  1e-80
dbj|AB021225.2|  Homo sapiens mt4-mmp mRNA for membrane-type...   304  1e-80
ref|NM_002424.1|  Homo sapiens matrix metalloproteinase 8 (n...   292  6e-77
gb|J05556.1|HUMCLGNA  Homo sapiens collagenase mRNA, complet...   292  6e-77
gb|U88652.1|OCU88652  Oryctolagus cuniculus macrophage metal...   288  8e-76
dbj|AB006779.1|AB006779  Oryctolagus cuniculus mRNA for matr...   288  1e-75
gb|AF144758.1|AF144758  Bos taurus MT1-MMP protein (MMP-14) ...   287  2e-75
ref|NM_008611.1|  Mus musculus matrix metalloproteinase 8 (M...   284  2e-74
gb|U96696.1|MMU96696  Mus musculus neutrophil collagenase MN...   284  2e-74
ref|NM_079128.1|  Drosophila melanogaster Matrix metalloprot...   282  8e-74
gb|AF271666.1|AF271666  Drosophila melanogaster matrix metal...   282  8e-74
ref|XM_080576.1|  Matrix metalloproteinase 1, mRNA                282  8e-74
emb|Y13342.1|MMY13342  Mus musculus mRNA for collagenase-2        282  8e-74
dbj|AK020292.1|AK020292  Mus musculus adult male cecum cDNA,...   281  1e-73
ref|NM_019471.1|  Mus musculus matrix metalloproteinase 10 (...   281  1e-73
emb|Y13185.1|MMMMP10  Mus musculus mRNA for stromelysin-2         281  1e-73
dbj|D82053.1|D82053  Cynops pyrrhogaster mRNA for stromelysi...   281  1e-73
gb|AF034087.1|AF034087  Equus caballus matrix metalloprotein...   281  1e-73
ref|NM_022221.1|  Rattus norvegicus neutrophil collagenease ...   280  4e-73
emb|AJ007288.1|RNO7288  Rattus norvegicus mRNA for neutrophi...   280  4e-73
ref|NM_002426.1|  Homo sapiens matrix metalloproteinase 12 (...   279  7e-73
gb|L23808.1|HUMHME  Human metalloproteinase (HME) mRNA, comp...   279  7e-73
emb|X05083.1|RNTRAN2R  RAT mRNA for oncogene-induced transin-2    278  1e-72
gb|M65253.1|RATTAP34A  Rat transformation-associated protein...   278  1e-72
gb|AF148882.1|AF148882  Equus caballus matrix metalloprotein...   277  2e-72
gb|AF201729.1|AF201729  Canis familiaris matrix metalloprote...   276  4e-72
emb|X05232.1|HSSTROMR  Human mRNA for stromelysin                 275  9e-72
ref|NM_002422.2|  Homo sapiens matrix metalloproteinase 3 (s...   275  9e-72
gb|J03209.1|HUMMMP3A  Human matrix metalloproteinase-3 (MMP-...   275  9e-72
emb|X75308.1|HSRNAC3  H.sapiens mRNA for collagenase 3            275  1e-71
ref|NM_002427.2|  Homo sapiens matrix metalloproteinase 13 (...   275  1e-71
emb|X81334.1|HSCOLLAG3  H.sapiens mRNA for collagenase-3 pro...   275  1e-71
emb|Z27093.1|XLSTROL3  X.laevis mRNA for stromelysin-3            274  2e-71
gb|U41824.1|XLU41824  Xenopus laevis collagenase-3 (gene A) ...   274  2e-71
gb|L49412.1|XELMMP1G  Xenopus laevis collagenase 3 (MMP-13) ...   273  3e-71
gb|AF059201.1|AF059201  Oryctolagus cuniculus collagenase-3 ...   273  4e-71
dbj|D82055.1|D82055  Cynops pyrrhogaster mRNA for collagenas...   273  4e-71
emb|X54925.1|HSCOLL1  H.sapiens mRNA for type I interstitial...   272  6e-71
ref|NM_002421.2|  Homo sapiens matrix metalloproteinase 1 (i...   272  6e-71
dbj|AK024818.1|AK024818  Homo sapiens cDNA: FLJ21165 fis, cl...   272  6e-71
gb|BC013875.1|BC013875  Homo sapiens, Similar to matrix meta...   272  6e-71
gb|M25664.1|RABSTROM  Rabbit metalloproteinase synovial cell...   271  1e-70
emb|X54724.1|SSMMP1  Porcine mmp1 mRNA for matrix metallopro...   271  1e-70
gb|M60616.1|RATCOL  Rat collagenase (UMRCase) mRNA, 3' end        271  2e-70
gb|AE003464.1|AE003464  Drosophila melanogaster genomic scaf...   204  3e-70
gb|AC099037.1|  Drosophila melanogaster, chromosome 2R, regi...   204  3e-70
gb|AC007925.5|AC007925  Drosophila melanogaster, chromosome ...   204  3e-70
gb|AC007581.5|AC007581  Drosophila melanogaster, chromosome ...   204  3e-70
emb|X05231.1|HSCOLLR  Human mRNA for collagenase (E.C. 3.4.24)    270  3e-70
gb|M13509.1|HUMCN2  Human skin collagenase mRNA, complete cds     270  4e-70
gb|BC006725.1|BC006725  Mus musculus, matrix metalloproteina...   268  9e-70
gb|L76275.1|XELCOLL  Xenopus laevis collagenase 4 precursor ...   268  9e-70
emb|X66402.1|MMSTLY  M.musculus mRNA for stromelysin 1            268  9e-70
ref|NM_010809.1|  Mus musculus matrix metalloproteinase 3 (M...   268  9e-70
emb|X63162.1|MMTRANS1  M.musculus mRNA for transin-1              268  9e-70
gb|AF072685.1|AF072685  Bos taurus matrix metalloproteinase ...   268  2e-69
gb|AF144760.1|AF144760  Bos taurus MT3-MMP protein (MMP-16) ...   268  2e-69
gb|BC002591.1|BC002591  Homo sapiens, matrix metalloproteina...   266  3e-69
gb|AF062392.1|AF062392  Gallus gallus matrix metalloproteina...   265  8e-69
ref|XM_058069.2|  Homo sapiens matrix metalloproteinase 12 (...   145  8e-69
ref|XM_040728.1|  Homo sapiens matrix metalloproteinase 10 (...   264  2e-68
ref|NM_002425.1|  Homo sapiens matrix metalloproteinase 10 (...   264  2e-68
emb|X07820.1|HSSTROM2  Human mRNA for metalloproteinase stro...   264  2e-68
emb|X58256.1|BTCLG  Bovine CLG mRNA for collagenase               263  4e-68
ref|NM_008607.1|  Mus musculus matrix metalloproteinase 13 (...   262  8e-68
emb|X66473.1|MMPCOLLAG  M.musculus mRNA for (pro)collagenase      262  8e-68
gb|AF009922.1|AF009922  Bos taurus enamel metalloproteinase ...   262  8e-68
ref|XM_009873.3|  Homo sapiens matrix metalloproteinase 11 (...   261  1e-67
emb|X57766.1|HSSTROL3  Human stromelysin-3 mRNA                   261  1e-67
ref|NM_005940.2|  Homo sapiens matrix metalloproteinase 11 (...   261  1e-67
emb|X02601.1|RNURFR1  Rat mRNA for 53 kD polypeptide induced...   260  3e-67
dbj|D82054.1|D82054  Cynops pyrrhogaster mRNA for stromelysi...   259  5e-67
dbj|AB043536.1|AB043536  Oncorhynchus mykiss mmp mRNA for ma...   258  9e-67
gb|U54825.1|SSU54825  Sus scrofa matrix metalloproteinase mR...   256  5e-66
ref|NM_008606.1|  Mus musculus matrix metalloproteinase 11 (...   256  5e-66
emb|Z12604.1|MMSTRMLY3  M.musculus mRNA for stromelysin-3         256  5e-66
ref|NM_013903.1|  Mus musculus matrix metalloproteinase 20 (...   256  6e-66
gb|AF155933.1|AF155933  Mus musculus matrix metalloproteinas...   256  6e-66
gb|AF281673.1|AF281673  Tupaia belangeri matrix metalloprote...   255  8e-66
emb|Y12779.1|HSENAMELY  H.sapiens mRNA for enamelysin             255  8e-66
ref|NM_004771.2|  Homo sapiens matrix metalloproteinase 20 (...   255  8e-66
gb|U62529.1|ECU62529  Equus caballus matrix metalloproteinas...   255  1e-65
gb|BC019135.1|BC019135  Mus musculus, Similar to matrix meta...   254  2e-65
dbj|AB028240.1|AB028240  Salmo salar mRNA for matrix metallo...   253  3e-65
ref|NM_032006.1|  Mus musculus collagenase-like A (Mcola-pen...   253  5e-65
emb|AJ278462.1|MMU278462  Mus musculus mRNA for putative mat...   253  5e-65
ref|NM_012980.1|  Rattus norvegicus Matrix metalloproteinase...   250  3e-64
gb|U46034.1|RNU46034  Rattus norvegicus stromelysin 3 mRNA, ...   250  3e-64
ref|NM_008605.1|  Mus musculus matrix metalloproteinase 12 (...   249  7e-64
gb|M82831.1|MUSMETELAS  Mus musculus macrophage metalloelast...   249  7e-64
ref|NM_053963.1|  Rattus norvegicus matrix metalloproteinase...   248  1e-63
emb|X98517.1|RNMME  R.norvegicus mRNA for macrophage metallo...   248  1e-63
gb|AF070478.1|AF070478  Gallus gallus matrix metalloproteina...   247  2e-63
ref|NM_022122.1|  Homo sapiens matrix metalloproteinase 27 (...   246  5e-63
gb|AF195192.1|AF195192  Homo sapiens matrix metalloprotease ...   246  5e-63
ref|NM_032007.1|  Mus musculus collagenase-like B (Mcolb-pen...   237  2e-60
emb|AJ278461.1|MMU278461  Mus musculus mRNA for putative mat...   237  2e-60
gb|U37791.1|HSU37791  Homo sapiens clone rasi-1 matrix metal...   224  3e-56
ref|NM_002429.2|  Homo sapiens matrix metalloproteinase 19 (...   224  3e-56
emb|X92521.1|HSMMP19  H.sapiens mRNA for MMP-19 protein           224  3e-56
gb|U38321.1|HSU38321  Homo sapiens clone rasi-11 matrix meta...   224  3e-56
emb|Y08622.1|HSRMMP18  H.sapiens mRNA for matrix metalloprot...   223  3e-56
gb|AC090980.5|  Homo sapiens chromosome 8, clone RP11-433O22...   223  4e-56
ref|NM_021412.1|  Mus musculus matrix metalloproteinase 19 (...   221  1e-55
gb|AF155221.1|AF155221  Mus musculus matrix metalloproteinas...   221  1e-55
gb|AF162446.1|AF162446  Mus musculus matrix metalloproteinas...   221  1e-55
gb|AF153199.1|AF153199  Mus musculus matrix metalloproteinas...   221  1e-55
gb|AF315683.1|AF315683  Homo sapiens matrix metalloproteinas...   215  1e-53
ref|NM_024302.2|  Homo sapiens matrix metalloproteinase 28 (...   215  1e-53
gb|AF219624.1|AF219624  Homo sapiens matrix metalloproteinas...   215  1e-53
gb|AF330002.1|AF330002  Homo sapiens matrix metalloprotease ...   215  1e-53
gb|AF162688.1|AF162688  Hydra vulgaris matrix metalloprotein...   209  8e-52
gb|AF354290.1|AF354290  Xenopus laevis matrix metalloprotein...   207  2e-51
ref|NM_032950.1|  Homo sapiens matrix metalloproteinase 28 (...   202  6e-50
gb|BC002631.1|BC002631  Homo sapiens, clone MGC:4164 IMAGE:3...   202  6e-50
ref|XM_083968.1|  Homo sapiens matrix metalloproteinase 28 (...   167  9e-49
emb|X53598.1|PLHE6R  P. lividus mRNA for hatching enzyme          191  1e-46
emb|AL121753.30|HSDJ614O4  Human DNA sequence from clone RP4...   188  2e-45
gb|U65656.1|RNU65656  Rattus norvegicus gelatinase A mRNA, c...   186  4e-45
gb|AY037943.1|  Xenopus laevis matrix metalloproteinase mRNA...   186  6e-45
ref|NM_008610.1|  Mus musculus matrix metalloproteinase 2 (M...   184  2e-44
gb|M84324.1|MUSIVCOL  Mus musculus type IV collagenase mRNA,...   184  2e-44
dbj|AB021698.1|AB021698  Oncorhynchus mykiss mRNA for matrix...   184  2e-44
ref|NM_031054.1|  Rattus norvegicus matrix metalloproteinase...   184  2e-44
emb|X71466.1|RNCOLL  R. Norvegicus mRNA for 72 KDa type IV c...   184  2e-44
dbj|AB031323.1|AB031323  Sus scrofa mRNA for matrilysin, com...   184  3e-44
gb|AF290428.1|AF290428  Bos taurus matrix metalloprotease 2 ...   184  3e-44
dbj|AB033754.2|AB033754  Oryzias latipes gel-a mRNA for gela...   182  6e-44
dbj|D63579.1|RABMM2  Oryctolagus cuniculus mRNA for matrix m...   182  1e-43
gb|AF177217.1|AF177217  Canis familiaris matrix metalloprote...   182  1e-43
gb|J03210.1|HUMCN4GEL  Human collagenase type IV mRNA, 3' end     181  2e-43
ref|XM_012503.2|  Homo sapiens matrix metalloproteinase 2 (g...   181  2e-43
ref|NM_004530.1|  Homo sapiens matrix metalloproteinase 2 (g...   181  2e-43
gb|BC002576.1|BC002576  Homo sapiens, matrix metalloproteina...   181  2e-43
gb|U07775.1|GGU07775  Gallus gallus prepro-72kDa matrix meta...   179  7e-43
gb|BC003635.1|BC003635  Homo sapiens, matrix metalloproteina...   178  1e-42
ref|NM_002423.2|  Homo sapiens matrix metalloproteinase 7 (m...   178  2e-42
emb|X07819.1|HSPUMP1  Human pump-1 mRNA homolog. to metallop...   178  2e-42
emb|Z11887.1|HSPUMP1G  H.sapiens PUMP-1 gene encoding PUMP        178  2e-42
gb|AF295805.1|AF295805  Sus scrofa gelatinase A (MMP-2) mRNA...   175  1e-41
dbj|AB000719.1|AB000719  Hemicentrotus pulcherrimus mRNA for...   174  2e-41
ref|NM_012864.1|  Rattus norvegicus Matrix metalloproteinase...   173  4e-41
gb|L24374.1|RATMPMM  Rattus norvegicus matrilysin (MMP-7) mR...   173  4e-41
dbj|AB057752.1|AB057752  Paralichthys olivaceus MMP2 mRNA fo...   170  3e-40
gb|AF144759.1|AF144759  Bos taurus MT2-MMP protein (MMP-15) ...   170  3e-40
ref|NM_010810.1|  Mus musculus matrix metalloproteinase 7 (M...   169  6e-40
gb|L36244.1|MUSMAT  Mus musculus metalloproteinase matrilysi...   169  6e-40
gb|U04444.1|FDU04444  Felis domesticus PUMP-1 mRNA, partial cds   167  2e-39
ref|NM_071389.1|  Caenorhabditis elegans                          166  8e-39
dbj|AB007815.1|AB007815  Caenorhabditis elegans mRNA for mat...   166  8e-39
ref|XM_017384.1|  Homo sapiens matrix metalloproteinase 7 (m...   135  8e-38
gb|AF097638.1|AF097638  Canis familiaris matrix metalloprote...   161  2e-37
gb|AF267159.1|AF267159  Ovis aries gelatinase A mRNA, partia...   157  3e-36
gb|AF134714.1|AF134714  Bos taurus MMP-1 protein mRNA, parti...   153  4e-35
gb|AF156935.1|AF156935  Synthetic construct stromelysin cata...   152  1e-34
gb|AF149850.1|AF149850  Canis familiaris matrix metalloprote...   150  5e-34
emb|AL133448.4|CNS01DV2  Human chromosome 14 DNA sequence **...   147  2e-33
emb|AL135998.6|CNS01DVO  Human chromosome 14 DNA sequence BA...   147  2e-33
gb|AF248646.1|AF248646  Homo sapiens matrix metalloproteinas...   142  1e-31
ref|XM_051704.1|  Homo sapiens matrix metalloproteinase 26 (...   142  1e-31
ref|NM_021801.2|  Homo sapiens matrix metalloproteinase 26 (...   142  1e-31
gb|AF022427.1|MM14MMP4  Mus musculus matrix metalloproteinas...   142  1e-31
gb|AF291664.1|AF291664  Homo sapiens matrix metalloproteinas...   142  1e-31
emb|AJ251531.1|HSA251531  Homo sapiens mRNA for matrilysin-2...   142  1e-31
gb|AF230354.1|AF230354  Homo sapiens matrix metalloproteinas...   141  2e-31
gb|U63725.1|GMU63725  Glycine max metalloproteinase mRNA, co...   139  1e-30
emb|X76537.1|MMSROM2  Mus musculus mRNA for stromelysin-2         138  1e-30
dbj|AB031324.1|AB031324  Sus scrofa mRNA for matrilysin-rela...   138  2e-30
dbj|AB057753.1|AB057753  Paralichthys olivaceus MMP9 mRNA fo...   137  4e-30
dbj|AB007817.1|AB007817  Caenorhabditis elegans mRNA for mat...   137  4e-30
gb|AF072455.1|AF072455  Xenopus laevis gelatinase B (MMP-9) ...   136  7e-30
gb|AF222690.1|AF222690  Gallus gallus 75 kDa gelatinase mRNA...   136  7e-30
dbj|AB057407.1|AB057407  Cyprinus carpio mRNA for matrix met...   135  9e-30
dbj|D82052.1|D82052  Cynops pyrrhogaster mRNA for gelatinase...   135  1e-29
dbj|AB033755.1|AB033755  Oryzias latipes gel-b mRNA for gela...   135  2e-29
gb|S75623.1|S75623  collagenase [Rana catesbeiana=bullfrags,...   135  2e-29
ref|NM_065193.1|  protease                                        133  4e-29
ref|NM_022791.1|  Homo sapiens matrix metalloproteinase 19 (...   133  4e-29
gb|U38431.1|HSU38431  Human clone rasi-6 matrix metalloprote...   133  4e-29
dbj|AB007816.1|AB007816  Caenorhabditis elegans mRNA for mat...   128  1e-27
ref|NM_130068.1|  Arabidopsis thaliana chromosome 2  CHR2v12...   128  2e-27
gb|AC007659.2|AC007659  Arabidopsis thaliana chromosome II s...   128  2e-27
gb|BC006093.1|BC006093  Homo sapiens, matrix metalloproteina...   127  4e-27
ref|NM_004994.1|  Homo sapiens matrix metalloproteinase 9 (g...   127  4e-27
gb|J05070.1|HUM4COLA  Human type IV collagenase mRNA, comple...   127  4e-27
dbj|AB044413.1|AB044413  Sus scrofa MMP-3 mRNA for matrix me...   127  4e-27
gb|U82541.1|XLU82541  Xenopus laevis matrix metalloproteinas...   127  4e-27
gb|AC005966.2|T2K10  Arabidopsis thaliana chromosome 1 BAC T...   125  9e-27
gb|AC007258.3|AC007258  Arabidopsis thaliana chromosome I BA...   125  9e-27
ref|NM_104689.1|  Arabidopsis thaliana chromosome 1  CHR1v12...   125  9e-27
ref|XM_061185.1|  Homo sapiens similar to matrix metalloprot...   125  9e-27
ref|NM_065195.1|  Caenorhabditis elegans                          125  2e-26
emb|X78324.1|BTMMP9  B.taurus bmmp9 mRNA for matrix metallop...   125  2e-26
gb|U89842.1|CFU89842  Canis familiaris gelatinase B mRNA, pa...   124  3e-26
ref|NM_105685.1|  Arabidopsis thaliana chromosome 1  CHR1v12...   124  4e-26
gb|AC002062.1|F20P5  Sequence of BAC F20P5 from Arabidopsis ...   124  4e-26
gb|AF169244.1|AF169244  Canis familiaris matrix metalloprote...   124  4e-26
dbj|AB006421.3|AB006421  Canis familiaris mRNA for matrix me...   123  5e-26
dbj|AB043996.1|AB043996  Bos taurus bmmp-9 mRNA for MMP-9, p...   123  5e-26
dbj|D26514.1|RABMM9  Rabbit mRNA for matrix metalloproteinas...   123  6e-26
gb|AF022971.1|AF022971  Caenorhabditis elegans cosmid C31B8,...   123  6e-26
gb|AF062640.1|AF062640  Arabidopsis thaliana metalloproteina...   122  8e-26
gb|U36476.1|RNU36476  Rattus norvegicus 92-kDa type IV colla...   122  1e-25
ref|NM_031055.1|  Rattus norvegicus matrix metalloproteinase...   122  1e-25
gb|U24441.1|RNU24441  Rattus norvegicus gelatinase B (GelB) ...   122  1e-25
gb|S67830.1|S67830  type IV collagenase=matrix metalloprotei...   121  2e-25
dbj|D12712.1|MUSGEL  Mouse mRNA for gelatinase, complete cds      121  2e-25
ref|NM_013599.1|  Mus musculus matrix metalloproteinase 9 (M...   121  2e-25
dbj|AK004651.1|AK004651  Mus musculus adult male lung cDNA, ...   121  2e-25
emb|Z27231.1|MMCLG4B  M.musculus mRNA for type IV collagenas...   121  2e-25
dbj|AB054185.1|AB054185  Cynops pyrrhogaster mRNA for matrix...   121  2e-25
emb|AL161544.2|ATCHRIV44  Arabidopsis thaliana DNA chromosom...   120  3e-25
emb|Z97341.2|ATFCA6  Arabidopsis thaliana DNA chromosome 4, ...   120  3e-25
ref|NM_117765.1|  Arabidopsis thaliana chromosome 4  CHR4v12...   120  3e-25
ref|NM_077711.1|  matrix metalloprotease                          120  3e-25
ref|NM_102260.1|  Arabidopsis thaliana chromosome 1  CHR1v12...   120  4e-25
gb|AC002396.1|AC002396  Arabidopsis thaliana chromosome I BA...   120  4e-25
gb|AF270937.1|AF270937  Plutella xylostella granulovirus gen...   118  2e-24
ref|XM_055373.2|  Homo sapiens hypothetical gene LOC115169 (...   117  4e-24
gb|AF135232.1|AF135232  Bos taurus MMP-3 protein mRNA, parti...   115  1e-23
gb|AF162221.1|AF162221  Xestia c-nigrum granulovirus genome,...   115  1e-23
emb|AJ133371.1|CSA133371  Cucumis sativus mRNA for matrix me...   114  2e-23
gb|AF011391.1|AF011391  Cavia porcellus collagenase-3 mRNA, ...   112  1e-22
dbj|AB043994.1|AB043994  Bos taurus bmmp-2 mRNA for MMP-2, p...   109  7e-22
ref|NM_004142.1|  Homo sapiens matrix metalloproteinase-like...   109  9e-22
emb|AJ003144.1|HSAJ03144  Homo sapiens mRNA for metalloprote...   109  9e-22
gb|AC069300.7|AC069300  Oryza sativa chromosome 10 BAC OSJNB...   109  9e-22
gb|AF201725.1|AF201725  Sus scrofa stromelysin (mmp3) mRNA, ...   108  1e-21
gb|AF303741.1|AF303741  Chilo iridescent virus complete genome    108  2e-21
gb|AF099191.1|AF099191  Caenorhabditis elegans MMP-like prot...   108  2e-21
gb|AF030866.1|AF030866  Mesocricetus auratus collagenase-3 m...   108  2e-21
ref|NM_066198.1|  zinc protease                                   108  2e-21
gb|U53466.2|U53466  Cydia pomonella granulovirus, complete g...   105  1e-20
gb|BC013118.1|BC013118  Homo sapiens, Similar to matrix meta...   103  6e-20
gb|AF260254.1|AF260254  Mesocricetus auratus matrix metallop...   102  8e-20
emb|AJ243311.1|ECA243311  Equus caballus mRNA for matrix met...   102  1e-19
emb|AJ010314.1|EAJ10314  Equus caballus mRNA for matrix meta...   102  1e-19
emb|X72795.1|MMMMP9B  M.musculus mRNA for gelatinase B            101  2e-19
gb|AF022428.1|MM14MMP5  Mus musculus matrix metalloproteinas...   100  3e-19
ref|NM_022792.1|  Homo sapiens matrix metalloproteinase 19 (...   100  4e-19
gb|U38322.1|HSU38322  Homo sapiens clone rasi-9 matrix metal...   100  4e-19
gb|AF150057.1|AF150057  Ambystoma mexicanum matrix metallopr...   100  4e-19
gb|AF135235.1|AF135235  Bos taurus MMP-13 protein mRNA, part...   100  7e-19
gb|AF135231.1|AF135231  Bos taurus MMP-2 protein mRNA, parti...    97  5e-18
gb|AF111100.1|AF111100  Canis familiaris matrix metalloprote...    97  6e-18
gb|AF150058.1|AF150058  Ambystoma mexicanum matrix metallopr...    94  4e-17
gb|AF202971.1|AF202971  Sus scrofa matrix metalloproteinase ...    94  4e-17
ref|NM_004659.1|  Homo sapiens matrix metalloproteinase 23A ...    94  4e-17
gb|AF056200.1|AF056200  Homo sapiens metalloprotease mmp21/2...    94  4e-17
gb|AC005302.70|  Mus musculus chromosome 10 clone rp21-481n4...    94  5e-17
ref|XM_084061.1|  Homo sapiens matrix metalloproteinase 23B ...    94  5e-17
ref|NM_053606.1|  Rattus norvegicus Matrix metalloproteinase...    94  5e-17
dbj|AB010960.1|AB010960  Rattus norvegicus mRNA for MIFR, co...    94  5e-17
ref|NM_006983.1|  Homo sapiens matrix metalloproteinase 23B ...    94  5e-17
emb|AJ005256.1|HSAJ5256  Homo sapiens mRNA for MMP-23              94  5e-17
dbj|AB010961.1|AB010961  Homo sapiens mRNA for MIFR-1, compl...    94  5e-17
gb|AF150056.1|AF150056  Ambystoma mexicanum matrix metallopr...    93  7e-17
gb|AF135233.1|AF135233  Bos taurus MMP-7 protein mRNA, parti...    93  9e-17
gb|AE003832.2|AE003832  Drosophila melanogaster genomic scaf...    86  2e-16
gb|AC005894.1|AC005894  Drosophila melanogaster, chromosome ...    86  2e-16
gb|AC099009.1|  Drosophila melanogaster, chromosome 2R, regi...    86  2e-16
gb|AC006472.2|AC006472  Drosophila melanogaster, chromosome ...    86  2e-16
gb|AF069642.1|AF069642  Bos taurus matrix metalloproteinase ...    91  3e-16
ref|NM_011985.1|  Mus musculus matrix metalloproteinase 23 (...    91  3e-16
gb|AF085742.1|AF085742  Mus musculus CAMP metalloproteinase ...    91  3e-16
gb|AF055671.1|AF055671  Mesocricetus auratus collagenase 2 (...    90  6e-16
gb|AF069644.1|AF069644  Bos taurus matrix metalloproteinase ...    90  7e-16
gb|AF069641.1|AF069641  Sus scrofa matrix metalloproteinase ...    89  1e-15
gb|AF069643.1|AF069643  Sus scrofa matrix metalloproteinase ...    89  1e-15
gb|AF150055.1|AF150055  Ambystoma mexicanum matrix metallopr...    89  1e-15
gb|AF055670.1|AF055670  Cavia porcellus collagenase 2 (MMP-8...    87  6e-15
dbj|AP000647.4|AP000647  Homo sapiens genomic DNA, chromosom...    85  2e-14
dbj|AP000789.4|AP000789  Homo sapiens genomic DNA, chromosom...    84  3e-14
gb|AF022432.1|MM14MMP9  Mus musculus matrix metalloproteinas...    84  4e-14
gb|AF267157.1|AF267157  Ovis aries MMP-13 mRNA, partial cds        84  5e-14
gb|AF145123.1|AF145123  Ambystoma mexicanum matrix metallopr...    82  1e-13
gb|AF267158.1|AF267158  Ovis aries matrilysin mRNA, partial cds    82  2e-13
gb|U78045.1|HSU78045  Human collagenase and stromelysin gene...    82  2e-13
gb|AF277294.1|AF277294  Gnathostoma spinigerum matrix metall...    82  2e-13
gb|AF267156.1|AF267156  Ovis aries interstitial collagenase ...    80  6e-13
gb|AF022430.1|MM14MMP7  Mus musculus matrix metalloproteinas...    79  1e-12
gb|AC006237.1|AC006237  Homo sapiens chromosome 17, clone hR...    79  2e-12
gb|AF123396.1|AF123396  Canis familiaris gelatinase B mRNA, ...    77  4e-12
dbj|AP000619.4|AP000619  Homo sapiens genomic DNA, chromosom...    77  5e-12
gb|AC092352.2|  Homo sapiens chromosome 16 clone RP11-2M17, ...    76  8e-12
gb|AC007336.5|AC007336  Homo sapiens chromosome 16 clone RP1...    76  8e-12
gb|M55588.1|HUMCLG4Q08  Human collagenase type IV (CLG4) gen...    76  8e-12
emb|AJ003147.1|HSAJ03147  Homo sapiens complete genomic sequ...    75  1e-11
dbj|AP000851.4|AP000851  Homo sapiens genomic DNA, chromosom...    75  1e-11
emb|X03168.1|HSSPROT  Human mRNA for S-protein                     74  5e-11
gb|M17821.1|RABCN2  Oryctolagus cuniculus collagenase-1 prec...    74  5e-11
ref|XM_061993.1|  Homo sapiens similar to INTERSTITIAL COLLA...    73  7e-11
gb|M55442.1|RABGP66  O.cuniculus domesticus vitronectin (gly...    73  7e-11
gb|AY057902.1|  Glycine max matrix metalloproteinase MMP2 (M...    72  1e-10
emb|AJ006411.1|OMY6411  Oncorhynchus mykiss mRNA for collage...    72  2e-10
dbj|AK011736.1|AK011736  Mus musculus 10 days embryo whole b...    72  2e-10
gb|BC018521.1|BC018521  Mus musculus, vitronectin, clone MGC...    72  2e-10
gb|AF156951.1|F156947S05  Mus musculus matrix metalloprotein...    72  2e-10
gb|M77123.1|MUSVITA  Mouse vitronectin mRNA, complete cds          72  2e-10
ref|XM_031492.1|  Homo sapiens vitronectin (serum spreading ...    72  2e-10
ref|NM_011707.1|  Mus musculus vitronectin (Vtn), mRNA             72  2e-10
emb|X63003.1|MMVITN  M.musculus mRNA for vitronectin               72  2e-10
ref|NM_000638.2|  Homo sapiens vitronectin (serum spreading ...    72  2e-10
gb|BC012690.1|BC012690  Mus musculus, Similar to vitronectin...    72  2e-10
gb|BC005046.1|BC005046  Homo sapiens, clone MGC:12819 IMAGE:...    72  2e-10
dbj|AP000349.1|AP000349  Homo sapiens genomic DNA, chromosom...    67  2e-10
emb|Y11030.1|GGVITRO  G.gallus mRNA for vitronectin                71  4e-10
gb|U64803.1|CCU64803  Coturnix coturnix nectinepsin mRNA, co...    70  6e-10
emb|AJ332942.1|HSA332942  Homo sapiens genomic sequence surr...    69  1e-09
emb|X72794.1|MMMMP9A  M.musculus gene for gelatinase B             69  1e-09
ref|NM_019156.1|  Rattus norvegicus vitronectin (Vtn), mRNA        69  2e-09
gb|U44845.1|RNU44845  Rattus norvegicus vitronectin mRNA, co...    69  2e-09
gb|AF040648.2|  Caenorhabditis elegans cosmid H19M22, comple...    68  2e-09
ref|NM_074277.1|  zinc metalloprotease                             68  3e-09
gb|AF440693.1|AF440693  Mus musculus vitronectin mRNA, compl...    68  3e-09
emb|X65722.1|PLHATCHG  P.lividus gene for hatching enzyme          68  3e-09
gb|M55584.1|HUMCLG4Q04  Human collagenase type IV (CLG4) gen...    68  3e-09
gb|L22523.1|HUMMATRY05  Human matrilysin gene, exon 5              67  7e-09
gb|AF291665.1|AF291665  Homo sapiens matrix metalloproteinas...    67  7e-09
gb|AC090893.5|  Homo sapiens chromosome 11, clone RP11-390G2...    67  7e-09
dbj|AP001830.4|AP001830  Homo sapiens genomic DNA, chromosom...    67  7e-09
gb|AC018375.8|  Homo sapiens, clone RP11-3P24, complete sequ...    67  7e-09
gb|AF405705.1|AF405705  Homo sapiens matrix metalloproteinas...    66  9e-09
gb|AF156950.1|F156947S04  Mus musculus matrix metalloprotein...    66  1e-08
gb|L36240.1|MUSMAT04  Mus musculus metalloproteinase matrily...    66  1e-08
gb|M68346.1|HUMIVCOL04  Human type IV collagenase (CLG4B) ge...    66  1e-08
emb|AL162458.10|AL162458  Human DNA sequence from clone RP11...    66  1e-08
gb|M19240.1|RABCN4  Oryctolagus cuniculus collagenase-1 prec...    65  1e-08
emb|AJ338123.1|HSA338123  Homo sapiens genomic sequence surr...    65  1e-08
gb|AF022425.1|MM14MMP2  Mus musculus matrix metalloproteinas...    65  1e-08
dbj|AB043995.1|AB043995  Bos taurus bmmp-3 mRNA for MMP-3, p...    65  2e-08
gb|L22522.1|HUMMATRY04  Human matrilysin gene, exon 4              65  2e-08
emb|X07823.1|RN3TRAN4  Rat transin-3 gene exon 4                   65  3e-08
dbj|D63145.1|PIGVITRON  Pig mRNA for vitronectin, complete cds     64  3e-08
dbj|D61396.1|D61396  Porcine mRNA for vitronectin, complete cds    64  3e-08
emb|X07824.1|RN3TRAN5  Rat transin-3 gene exon 5                   64  6e-08
dbj|AB010962.1|AB010962  Homo sapiens mRNA for MIFR-2, compl...    63  7e-08
gb|AF057062.1|AF057062  Homo sapiens metalloprotease mmp21/2...    63  7e-08
dbj|AP001486.4|AP001486  Homo sapiens genomic DNA, chromosom...    62  2e-07
emb|AJ329935.1|HSA329935  Homo sapiens genomic sequence surr...    60  6e-07
ref|XM_083245.1|  4878, mRNA                                       60  8e-07
emb|AJ339481.1|HSA339481  Homo sapiens genomic sequence surr...    59  1e-06
gb|L36239.1|MUSMAT05  Mus musculus metalloproteinase matrily...    59  1e-06
gb|M64996.1|CRBLIMUNEC  Limulus polyphemus limunectin gene         59  1e-06
gb|U51571.1|CPU51571  Cavia porcellus stromelysin 1 mRNA, pa...    49  1e-06
gb|M68350.1|HUMIVCOL08  Human type IV collagenase (CLG4B) ge...    59  1e-06
ref|NM_022790.1|  Homo sapiens matrix metalloproteinase 19 (...    56  1e-06
gb|U38320.1|HSU38320  Homo sapiens clone rasi-3 matrix metal...    56  1e-06
gb|U00037.1|CELT20H4  Caenorhabditis elegans cosmid T20H4          59  2e-06
gb|U00038.2|  Caenorhabditis elegans cosmid T21D11, complete...    59  2e-06
ref|NM_021400.1|  Mus musculus proteoglycan 3 (megakaryocyte...    57  5e-06
dbj|AB034730.1|AB034730  Mus musculus mRNA, complete cds, si...    57  5e-06
gb|U70919.1|XCU70919  Xestia c-nigrum granulosis virus matri...    57  5e-06
gb|M17822.1|RABCN3  Oryctolagus cuniculus collagenase-1 prec...    56  9e-06
emb|X81640.1|HSCGN3PRO  H.sapiens promoter region of collage...    56  1e-05
emb|X64020.1|RNTST2B  R.norvegicus mRNA for transin/stromely...    54  1e-05
gb|U41266.1|  Caenorhabditis elegans cosmid EGAP1, complete ...    55  3e-05
emb|AJ339486.1|HSA339486  Homo sapiens genomic sequence surr...    55  3e-05
gb|AF022426.1|MM14MMP3  Mus musculus matrix metalloproteinas...    55  3e-05
gb|M55591.1|HUMCLG4Q11  Human collagenase type IV (CLG4) gen...    54  6e-05
emb|Z95309.1|CEH36L18  Caenorhabditis elegans cosmid H36L18,...    51  6e-05
gb|AF156948.1|F156947S02  Mus musculus matrix metalloprotein...    52  1e-04
gb|AF147104.1|AF147104  Canis familiaris type IV collagenase...    52  2e-04
gb|AF022431.1|MM14MMP8  Mus musculus matrix metalloproteinas...    52  2e-04
gb|AC022911.6|  Homo sapiens chromosome 18, clone RP11-722A1...    36  8e-04
gb|AF056218.1|AF056218  Bos taurus superficial zone protein ...    50  8e-04
gb|AF281360.1|  Oncorhynchus mykiss putative vitronectin-lik...    50  8e-04
ref|XM_001738.4|  Homo sapiens proteoglycan 4, (megakaryocyt...    50  8e-04
ref|NM_005807.1|  Homo sapiens proteoglycan 4, (megakaryocyt...    50  8e-04
gb|U70136.1|HSU70136  Human megakaryocyte stimulating factor...    50  8e-04
dbj|AK057197.1|AK057197  Homo sapiens cDNA FLJ32635 fis, clo...    50  8e-04
emb|AJ338213.1|HSA338213  Homo sapiens genomic sequence surr...    49  0.001
gb|U25950.1|PMU25950  Proteus mirabilis metalloprotease gene...    48  0.003
gb|L22520.1|HUMMATRY02  Human matrilysin gene, exon 2              48  0.003
gb|M55582.1|HUMCLG4Q02  Human collagenase type IV (CLG4) gen...    48  0.003
gb|AF064762.1|AF064762  Proteus mirabilis metalloprotease op...    48  0.003
ref|NM_000613.1|  Homo sapiens hemopexin (HPX), mRNA               47  0.004
gb|J03048.1|HUMHXMA  Huma hemopexin mRNA, 3' end                   47  0.004
emb|X02537.1|HSHEPEXR  Human mRNA for serum beta-glycoprotei...    47  0.004
gb|BC005395.1|BC005395  Homo sapiens, Similar to hemopexin, ...    47  0.004
gb|AF057061.1|AF057061  Homo sapiens metalloprotease mmp21/2...    47  0.004
gb|L36242.1|MUSMAT02  Mus musculus metalloproteinase matrily...    46  0.009
gb|AF147750.1|AF147750  Canis familiaris matrix metalloprote...    46  0.009
emb|X16429.1|OCHEMOPEX  O.cuniculus mRNA for hemopexin             46  0.009
emb|Y18249.1|MTY18249  Medicago truncatula mRNA for MtN9 gen...    45  0.027
emb|AL360176.22|AL360176  Human DNA sequence from clone RP11...    44  0.046
gb|AF022429.1|MM14MMP6  Mus musculus matrix metalloproteinas...    44  0.061
gb|M60395.1|ERWPRTBCDE  Erwinia chrysanthemi prt locus encod...    43  0.10
gb|M59229.1|ERWPRTCA  E.chrysanthemi metalloprotease C (prtC...    43  0.10
gb|AY064211.1|  Caulobacter crescentus S-layer editing metal...    42  0.14
gb|AE005750.1|AE005750  Caulobacter crescentus  section 76 o...    42  0.18
emb|Y17314.1|PSY17314  Pseudomonas sp. 'TAC II 18' PAPRA gene      42  0.18
gb|BC011774.1|BC011774  Homo sapiens, Similar to matrix meta...    42  0.18
emb|X07821.1|RN3TRAN2  Rat transin-3 gene exon 2                   42  0.23
emb|X04127.1|SSPROT  Serratia (sp. E-15) gene for extracellu...    41  0.39
emb|X55521.1|SMMESM6  Serratia marcescens metalloprotease gene     41  0.39
gb|U14751.1|SSU14751  Sus scrofa hyaluronidase mRNA, complet...    41  0.39
gb|AF063866.1|AF063866  Melanoplus sanguinipes entomopoxviru...    41  0.39
gb|M68344.1|HUMIVCOL02  Human type IV collagenase (CLG4B) ge...    40  0.51
gb|AE007196.1|AE007196  Sinorhizobium meliloti plasmid pSymA...    40  0.51
gb|AF086353.1|HUMZD63C05  Homo sapiens full length insert cD...    40  0.67
dbj|AB052623.1|AB052623  Cyprinus carpio wap65 mRNA for warm...    39  1.1
gb|AC024801.2|  Caenorhabditis elegans cosmid Y50D7A, comple...    39  1.1
emb|AJ007827.1|PTO7827  Pseudomonas tolaasii eprA, eprI, epr...    39  1.1
ref|XM_100736.1|  Homo sapiens LOC160118 (LOC160118), mRNA         39  1.5
gb|AF055334.1|AF055334  Homo sapiens metalloprotease isoform...    39  1.5
emb|AL031282.1|HS283E3  Human DNA sequence from clone 283E3 ...    39  1.5
dbj|AB031068.1|AB031068  Homo sapiens gene for MIFR/Femalysi...    39  1.5
gb|AC002324.1|AC002324  Mus musculus chromosome 11, clone 47...    39  2.0
emb|X72091.1|MMVITRO  M.musculus gene for vitronectin              39  2.0
dbj|AB013895.1|AB013895  Pseudomonas fluorescens gene for me...    39  2.0
gb|U20861.1|  Caenorhabditis elegans cosmid C28H8, complete ...    38  2.5
emb|X70011.1|ECPROTA  E.chrysanthemi gene for protease A           38  3.3
gb|M37390.1|ERWPRTC  E.chrysanthemi metalloprotease C (prtC)...    38  3.3
gb|AF083061.1|AF083061  Pseudomonas fluorescens protease Prt...    38  3.3
gb|M62642.1|RATHMPX  Rat (clone pRHx1) hemopexin mRNA, compl...    37  4.3
ref|NM_053318.1|  Rattus norvegicus hemopexin (Hpx), mRNA          37  4.3
gb|M93262.1|ERWPRTAB  Erwinia chrysanthemi (prtA and prtB) g...    37  4.3
gb|AF004848.1|AF004848  Pseudomonas fluorescens alkaline pro...    37  5.7
gb|AF393466.1|AF393466  Uncultured crenarchaeote 74A4 partia...    37  5.7
emb|AJ414160.1|AJ414160  Yersinia pestis strain CO92 complet...    37  5.7
gb|BC011246.1|BC011246  Mus musculus, clone MGC:19095 IMAGE:...    37  7.4
gb|U89889.1|MMU89889  Mus musculus hemopexin mRNA, partial cds     37  7.4
gb|AF286062.1|AF286062  Pseudomonas brassicacearum phase var...    37  7.4
gb|BC019901.1|BC019901  Homo sapiens, clone MGC:29981 IMAGE:...    37  7.4
>gb|U66463.1|GGU66463 Gallus gallus membrane type-matrix metalloproteinase (MT3-MMP)
           mRNA, complete cds
          Length = 5736

 Score = 1187 bits (3071), Expect = 0.0
 Identities = 571/608 (93%), Positives = 571/608 (93%)
 Frame = +1

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 115 MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 294

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 295 SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 474

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR
Sbjct: 475 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 654

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 655 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 834

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 835 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDRIPPPT 1014

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTLVILRREMF
Sbjct: 1015RPLPTVPPHRSIPPADPRKNDRQPKPPRPPTGDKPSYPGAKPNICDGNFNTLVILRREMF 1194

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT
Sbjct: 1195VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 1374

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT
Sbjct: 1375LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 1554

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRD 540
           IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRD
Sbjct: 1555IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRD 1734

Query: 541 KDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYC 600
           KDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYC
Sbjct: 1735KDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYC 1914

Query: 601 KRSMQEWV 608
           KRSMQEWV
Sbjct: 1915KRSMQEWV 1938
>ref|NM_005941.2| Homo sapiens matrix metalloproteinase 16 (membrane-inserted)
           (MMP16), transcript variant 1, mRNA
          Length = 2589

 Score = 1100 bits (2846), Expect = 0.0
 Identities = 528/609 (86%), Positives = 544/609 (88%), Gaps = 1/609 (0%)
 Frame = +2

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+L  STG RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 113 MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 292

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKF+IRRKRY
Sbjct: 293 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY 472

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 473 ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR 652

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 653 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 832

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 833 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 1012

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 1013RPLPTVPPHRSIPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1186

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1187VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1366

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLGSGIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1367LQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1546

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           +WKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1547VWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 1726

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
            K+ HSP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1727VKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1906

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1907CKRSMQEWV 1933
>dbj|D83646.1|HUMMETALL Homo sapiens mRNA for metalloproteinase, complete cds
          Length = 2477

 Score = 1100 bits (2846), Expect = 0.0
 Identities = 528/609 (86%), Positives = 544/609 (88%), Gaps = 1/609 (0%)
 Frame = +1

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+L  STG RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 1   MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 180

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKF+IRRKRY
Sbjct: 181 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY 360

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 361 ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR 540

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 541 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 720

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 721 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 900

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 901 RPLPTVPPHRSIPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1074

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1075VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1254

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLGSGIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1255LQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1434

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           +WKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1435VWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 1614

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
            K+ HSP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1615VKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1794

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1795CKRSMQEWV 1821
>dbj|D85511.1|D85511 Homo sapiens mRNA for MT3-MMP, complete cds
          Length = 2052

 Score = 1100 bits (2846), Expect = 0.0
 Identities = 528/609 (86%), Positives = 544/609 (88%), Gaps = 1/609 (0%)
 Frame = +3

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+L  STG RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 36  MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 215

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKF+IRRKRY
Sbjct: 216 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY 395

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 396 ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR 575

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 576 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 755

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 756 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 935

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 936 RPLPTVPPHRSIPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1109

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1110VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1289

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLGSGIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1290LQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1469

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           +WKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1470VWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 1649

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
            K+ HSP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1650VKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1829

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1830CKRSMQEWV 1856
>ref|NM_019724.1| Mus musculus matrix metalloproteinase 16 (Mmp16), mRNA
          Length = 2055

 Score = 1099 bits (2843), Expect = 0.0
 Identities = 527/609 (86%), Positives = 545/609 (88%), Gaps = 1/609 (0%)
 Frame = +1

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+LA S+G RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 55  MILLAFSSGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 234

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 235 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 414

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETR+AIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 415 ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR 594

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 595 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 774

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 775 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 954

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRS+PPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 955 RPLPTVPPHRSVPPA--DPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1128

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1129VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1308

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLG+GIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1309LQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1488

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           IWKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1489IWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 1668

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
           DK+  SP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1669DKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1848

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1849CKRSMQEWV 1875
>dbj|AB021228.1|AB021228 Mus musculus mRNA for membrane-type-3 matrix metalloproteinase,
           complete cds
          Length = 2055

 Score = 1099 bits (2843), Expect = 0.0
 Identities = 527/609 (86%), Positives = 545/609 (88%), Gaps = 1/609 (0%)
 Frame = +1

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+LA S+G RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 55  MILLAFSSGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 234

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 235 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 414

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETR+AIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 415 ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR 594

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 595 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 774

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 775 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 954

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRS+PPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 955 RPLPTVPPHRSVPPA--DPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1128

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1129VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1308

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLG+GIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1309LQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1488

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           IWKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1489IWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 1668

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
           DK+  SP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1669DKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1848

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1849CKRSMQEWV 1875
>dbj|AB009303.1|AB009303 Homo sapiens mRNA for membrane-type matrix metalloproteinase 3,
           complete cds
          Length = 2116

 Score = 1098 bits (2841), Expect = 0.0
 Identities = 527/609 (86%), Positives = 544/609 (88%), Gaps = 1/609 (0%)
 Frame = +2

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+L  STG RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 113 MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 292

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKF+IRRKRY
Sbjct: 293 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY 472

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 473 ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR 652

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 653 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 832

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 833 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 1012

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 1013RPLPTVPPHRSIPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1186

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1187VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1366

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLGSGIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1367LQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1546

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           +WKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPG+PRSILKDFMGCDGPTDR
Sbjct: 1547VWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGHPRSILKDFMGCDGPTDR 1726

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
            K+ HSP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1727VKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1906

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1907CKRSMQEWV 1933
>gb|AF282844.1|AF282844 Mus musculus matrix metalloproteinase 16 (Mmp16) mRNA, complete cds
          Length = 1880

 Score = 1097 bits (2838), Expect = 0.0
 Identities = 526/609 (86%), Positives = 545/609 (89%), Gaps = 1/609 (0%)
 Frame = +1

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+LA S+G RLDFV +S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 7   MILLAFSSGRRLDFVHRSVVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 186

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 187 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 366

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETR+AIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 367 ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR 546

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGD SPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 547 DVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 726

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 727 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 906

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRS+PPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 907 RPLPTVPPHRSVPPA--DPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1080

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1081VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1260

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLG+GIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1261LQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1440

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           IWKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1441IWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 1620

Query: 540 DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
           DK+  SP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 1621DKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 1800

Query: 600 CKRSMQEWV 608
           CKRSMQEWV
Sbjct: 1801CKRSMQEWV 1827
>dbj|D85509.1|D85509 Rattus rattus mRNA for MT3-MMP, complete cds
          Length = 3517

 Score = 1096 bits (2835), Expect = 0.0
 Identities = 525/609 (86%), Positives = 544/609 (89%), Gaps = 1/609 (0%)
 Frame = +3

Query: 1    MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
            MI+LA S+G RLDFV +S V F QT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 432  MILLAFSSGRRLDFVHRSGVFFFQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 611

Query: 61   SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
            SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 612  SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 791

Query: 121  ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
            ALTGQKWQHKHI YSIKNVTPKVGD ETR+AIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 792  ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR 971

Query: 181  DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
            DVDITIIFASGFHGD SPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 972  DVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 1151

Query: 241  FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
            FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 1152 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 1331

Query: 301  XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                    HRS+PPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 1332 RPLPTVPPHRSVPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1505

Query: 361  VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
            VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1506 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1685

Query: 421  LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
            LQPGYPHDLITLG+GIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1686 LQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1865

Query: 481  IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
            IWKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1866 IWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 2045

Query: 540  DKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILY 599
            DK+  SP DDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILY
Sbjct: 2046 DKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILY 2225

Query: 600  CKRSMQEWV 608
            CKRSMQEWV
Sbjct: 2226 CKRSMQEWV 2252
>ref|NM_080776.1| Rattus norvegicus matrix metalloproteinase 16 (Mmp16), mRNA
          Length = 3519

 Score =  978 bits (2527), Expect(2) = 0.0
 Identities = 466/547 (85%), Positives = 483/547 (88%), Gaps = 1/547 (0%)
 Frame = +3

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+LA S+G RLDFV +S V F QT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 432 MILLAFSSGRRLDFVHRSGVFFFQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 611

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 612 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 791

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETR+AIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 792 ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR 971

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGD SPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 972 DVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 1151

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 1152FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 1331

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRS+PPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 1332RPLPTVPPHRSVPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1505

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1506VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1685

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLG+GIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1686LQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1865

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           IWKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1866IWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 2045

Query: 540 DKDRHSP 546
           DK+  SP
Sbjct: 2046DKEGLSP 2066
 Score = 67.4 bits (163), Expect(2) = 0.0
 Identities = 30/31 (96%), Positives = 31/31 (99%)
 Frame = +2

Query: 578  LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
            LLVLVYTVFQFKR+GTPRHILYCKRSMQEWV
Sbjct: 2162 LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV 2254
 Score = 56.2 bits (134), Expect = 9e-06
 Identities = 39/83 (46%), Positives = 44/83 (52%), Gaps = 11/83 (13%)
 Frame = +1

Query: 505  KEKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRD-----------KDRHSPQDDVDII 553
            KE+S GNST              K  +G   P+ R            K   +   DVDI+
Sbjct: 1939 KERSIGNSTTRYS----------K*NLGIQDPSSRTLWAVMDQQTEIKKVSAHHHDVDIV 2088

Query: 554  IKLDNTASTVKAIAIVIPCILAL 576
            IKLDNTASTVKAIAIVIPCILAL
Sbjct: 2089 IKLDNTASTVKAIAIVIPCILAL 2157
>dbj|D63886.1|D63886 Rattus sp. mRNA for MT3-MMP-del, complete cds
          Length = 3519

 Score =  978 bits (2527), Expect(2) = 0.0
 Identities = 466/547 (85%), Positives = 483/547 (88%), Gaps = 1/547 (0%)
 Frame = +3

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+LA S+G RLDFV +S V F QT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 432 MILLAFSSGRRLDFVHRSGVFFFQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 611

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
Sbjct: 612 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 791

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETR+AIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 792 ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR 971

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGD SPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 972 DVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 1151

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 1152FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 1331

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRS+PPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 1332RPLPTVPPHRSVPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1505

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK NK+WVFKDTT
Sbjct: 1506VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTT 1685

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           LQPGYPHDLITLG+GIP HGIDSAIWWEDVGKTYFFKGDRYWRY EEM++MDPGYPKPIT
Sbjct: 1686LQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT 1865

Query: 481 IWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDR 539
           IWKGIPESPQGAFVHKENGFTYF K K     + ++L+VEPGYPRSILKDFMGCDGPTDR
Sbjct: 1866IWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDR 2045

Query: 540 DKDRHSP 546
           DK+  SP
Sbjct: 2046DKEGLSP 2066
 Score = 67.4 bits (163), Expect(2) = 0.0
 Identities = 30/31 (96%), Positives = 31/31 (99%)
 Frame = +2

Query: 578  LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
            LLVLVYTVFQFKR+GTPRHILYCKRSMQEWV
Sbjct: 2162 LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV 2254
 Score = 56.2 bits (134), Expect = 9e-06
 Identities = 39/83 (46%), Positives = 44/83 (52%), Gaps = 11/83 (13%)
 Frame = +1

Query: 505  KEKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRD-----------KDRHSPQDDVDII 553
            KE+S GNST              K  +G   P+ R            K   +   DVDI+
Sbjct: 1939 KERSIGNSTTRYS----------K*NLGIQDPSSRTLWAVMDQQTEIKKVSAHHHDVDIV 2088

Query: 554  IKLDNTASTVKAIAIVIPCILAL 576
            IKLDNTASTVKAIAIVIPCILAL
Sbjct: 2089 IKLDNTASTVKAIAIVIPCILAL 2157
>gb|AF244994.1|AF244994 Scyliorhinus torazame membrane type-3 matrix metalloproteinase
           (MT3-MMP) mRNA, complete cds
          Length = 1842

 Score =  893 bits (2308), Expect = 0.0
 Identities = 426/604 (70%), Positives = 480/604 (78%), Gaps = 1/604 (0%)
 Frame = +1

Query: 6   LSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRS 65
           L  G +L FV  S   +LQT +WI+C+ VC  EQ F+VE+WLQKYGYL  ++PRMSVLRS
Sbjct: 34  LYKGKQLAFV-YSGAFYLQTLLWIICS-VCGEEQPFSVEIWLQKYGYLQASEPRMSVLRS 207

Query: 66  AETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQ 125
           +++M SA+AAMQQFYGI +TG +D NTIDWMKKPRCGVPDQ   S +F++RRKRYALTGQ
Sbjct: 208 SQSMHSAVAAMQQFYGIKVTGTLDENTIDWMKKPRCGVPDQFGSSIRFSVRRKRYALTGQ 387

Query: 126 KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDIT 185
           KW HKHI YSIKN TPKVG  ET +AIRRAFDVWQNVTPLTFEE+PY+ELEN KRDVDIT
Sbjct: 388 KWHHKHITYSIKNFTPKVGKLETHRAIRRAFDVWQNVTPLTFEEIPYVELENKKRDVDIT 567

Query: 186 IIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAV 245
           I+FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVA 
Sbjct: 568 IMFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAA 747

Query: 246 HELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXX 305
           HELGHALGLEHSNDP+AIMAPFYQYM+T+NF+LP DDLQGIQKIYG              
Sbjct: 748 HELGHALGLEHSNDPSAIMAPFYQYMDTENFQLPQDDLQGIQKIYGPPDKIAHPTKPLPT 927

Query: 306 XXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQ 365
              HR  PP+                    S+PGAKPNICDGNFNTL ILR EMFVFKD 
Sbjct: 928 VPPHRFNPPSDPRKPSRQPRPPRPPTRDKPSFPGAKPNICDGNFNTLAILRGEMFVFKDH 1107

Query: 366 WFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGY 425
           WFWRVRNNRV+DGYPMQI YFWRGLP    +    ++G FVF K +K+WVFK+ TL+ GY
Sbjct: 1108WFWRVRNNRVLDGYPMQIAYFWRGLPSKHLSSLGTADGKFVFLKGSKYWVFKEATLELGY 1287

Query: 426 PHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGI 485
           P +++ LGSG+PS GIDSA+WWEDVGKTYFFKGDRYWRY EE   +  GYPK I+IWKGI
Sbjct: 1288PQNVVELGSGVPSQGIDSAVWWEDVGKTYFFKGDRYWRYNEETHVVGSGYPKSISIWKGI 1467

Query: 486 PESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGPTDRDKDRH 544
           P+SPQGAFV KE+G+T+F K K     +   LRVEP YPRSILK++MGCD     DKDRH
Sbjct: 1468PKSPQGAFVSKESGYTFFYKGKEYWKFNNHKLRVEPSYPRSILKEWMGCDRTKTGDKDRH 1647

Query: 545 SPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSM 604
             QDDVDI+IK+DNT STV AIAIVIPC LALC LVL+YTV QFKR+GTPRHILY KRSM
Sbjct: 1648DTQDDVDIVIKIDNTLSTVNAIAIVIPCTLALCFLVLIYTVVQFKRKGTPRHILYSKRSM 1827

Query: 605 QEWV 608
           QEWV
Sbjct: 1828QEWV 1839
>ref|NM_006690.2| Homo sapiens matrix metalloproteinase 24 (membrane-inserted)
           (MMP24), mRNA
          Length = 2623

 Score =  765 bits (1976), Expect = 0.0
 Identities = 366/587 (62%), Positives = 439/587 (74%), Gaps = 2/587 (0%)
 Frame = +1

Query: 24  QTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGIN 83
           +  V +  A   +AE  F  + WL+ YGYL P D R S L SA+ +QSA++ MQQFYGI 
Sbjct: 187 RAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIP 366

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKV 143
           +TG +D+ TI+WMKKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKV
Sbjct: 367 VTGVLDQTTIEWMKKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKV 540

Query: 144 GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEG 203
           G+ +TRKAIR+AFDVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEG
Sbjct: 541 GELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEG 720

Query: 204 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAI 263
           GFLAHAYFPGPGIGGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHS+DP+AI
Sbjct: 721 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAI 900

Query: 264 MAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXX 323
           MAPFYQYMET NFKLP DDLQGIQKIYG                  R   P+        
Sbjct: 901 MAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERQ 1077

Query: 324 XXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQI 383
                       S PG KPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI
Sbjct: 1078PRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQI 1257

Query: 384 TYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDS 443
             FW+GLP  IDA YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+
Sbjct: 1258EQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDT 1437

Query: 444 AIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYF 503
           A+ WE VGKTYFFKG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF
Sbjct: 1438ALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYF 1617

Query: 504 IKEKSTGN-STKMLRVEPGYPRSILKDFMGCD-GPTDRDKDRHSPQDDVDIIIKLDNTAS 561
            K +       + L VEPGYPR+IL+D+MGC+    +R K+R  PQDDVDI++ +++   
Sbjct: 1618YKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPG 1797

Query: 562 TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +V A+A+VIPCIL+LC+LVLVYT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1798SVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV 1938
>dbj|AB021227.1|AB021227 Homo sapiens mRNA for membrane-type-5 matrix metalloproteinase,
           complete cds
          Length = 2623

 Score =  765 bits (1976), Expect = 0.0
 Identities = 366/587 (62%), Positives = 439/587 (74%), Gaps = 2/587 (0%)
 Frame = +1

Query: 24  QTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGIN 83
           +  V +  A   +AE  F  + WL+ YGYL P D R S L SA+ +QSA++ MQQFYGI 
Sbjct: 187 RAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIP 366

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKV 143
           +TG +D+ TI+WMKKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKV
Sbjct: 367 VTGVLDQTTIEWMKKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKV 540

Query: 144 GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEG 203
           G+ +TRKAIR+AFDVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEG
Sbjct: 541 GELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEG 720

Query: 204 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAI 263
           GFLAHAYFPGPGIGGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHS+DP+AI
Sbjct: 721 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAI 900

Query: 264 MAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXX 323
           MAPFYQYMET NFKLP DDLQGIQKIYG                  R   P+        
Sbjct: 901 MAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERQ 1077

Query: 324 XXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQI 383
                       S PG KPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI
Sbjct: 1078PRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQI 1257

Query: 384 TYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDS 443
             FW+GLP  IDA YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+
Sbjct: 1258EQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDT 1437

Query: 444 AIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYF 503
           A+ WE VGKTYFFKG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF
Sbjct: 1438ALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYF 1617

Query: 504 IKEKSTGN-STKMLRVEPGYPRSILKDFMGCD-GPTDRDKDRHSPQDDVDIIIKLDNTAS 561
            K +       + L VEPGYPR+IL+D+MGC+    +R K+R  PQDDVDI++ +++   
Sbjct: 1618YKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPG 1797

Query: 562 TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +V A+A+VIPCIL+LC+LVLVYT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1798SVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV 1938
>gb|AF131284.1|AF131284 Homo sapiens membrane type 5 matrix metalloproteinase (MMP24) mRNA,
           complete cds
          Length = 2118

 Score =  765 bits (1976), Expect = 0.0
 Identities = 366/587 (62%), Positives = 439/587 (74%), Gaps = 2/587 (0%)
 Frame = +1

Query: 24  QTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGIN 83
           +  V +  A   +AE  F  + WL+ YGYL P D R S L SA+ +QSA++ MQQFYGI 
Sbjct: 184 RAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIP 363

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKV 143
           +TG +D+ TI+WMKKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKV
Sbjct: 364 VTGVLDQTTIEWMKKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKV 537

Query: 144 GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEG 203
           G+ +TRKAIR+AFDVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEG
Sbjct: 538 GELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEG 717

Query: 204 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAI 263
           GFLAHAYFPGPGIGGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHS+DP+AI
Sbjct: 718 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAI 897

Query: 264 MAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXX 323
           MAPFYQYMET NFKLP DDLQGIQKIYG                  R   P+        
Sbjct: 898 MAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERQ 1074

Query: 324 XXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQI 383
                       S PG KPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI
Sbjct: 1075PRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQI 1254

Query: 384 TYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDS 443
             FW+GLP  IDA YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+
Sbjct: 1255EQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDT 1434

Query: 444 AIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYF 503
           A+ WE VGKTYFFKG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF
Sbjct: 1435ALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYF 1614

Query: 504 IKEKSTGN-STKMLRVEPGYPRSILKDFMGCD-GPTDRDKDRHSPQDDVDIIIKLDNTAS 561
            K +       + L VEPGYPR+IL+D+MGC+    +R K+R  PQDDVDI++ +++   
Sbjct: 1615YKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPG 1794

Query: 562 TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +V A+A+VIPCIL+LC+LVLVYT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1795SVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV 1935
>ref|XM_047216.1| Homo sapiens matrix metalloproteinase 24 (membrane-inserted)
           (MMP24), mRNA
          Length = 2464

 Score =  765 bits (1976), Expect = 0.0
 Identities = 366/587 (62%), Positives = 439/587 (74%), Gaps = 2/587 (0%)
 Frame = +1

Query: 24  QTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGIN 83
           +  V +  A   +AE  F  + WL+ YGYL P D R S L SA+ +QSA++ MQQFYGI 
Sbjct: 25  RAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIP 204

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKV 143
           +TG +D+ TI+WMKKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKV
Sbjct: 205 VTGVLDQTTIEWMKKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKV 378

Query: 144 GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEG 203
           G+ +TRKAIR+AFDVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEG
Sbjct: 379 GELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEG 558

Query: 204 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAI 263
           GFLAHAYFPGPGIGGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHS+DP+AI
Sbjct: 559 GFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAI 738

Query: 264 MAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXX 323
           MAPFYQYMET NFKLP DDLQGIQKIYG                  R   P+        
Sbjct: 739 MAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERQ 915

Query: 324 XXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQI 383
                       S PG KPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI
Sbjct: 916 PRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQI 1095

Query: 384 TYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDS 443
             FW+GLP  IDA YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+
Sbjct: 1096EQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDT 1275

Query: 444 AIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYF 503
           A+ WE VGKTYFFKG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF
Sbjct: 1276ALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYF 1455

Query: 504 IKEKSTGN-STKMLRVEPGYPRSILKDFMGCD-GPTDRDKDRHSPQDDVDIIIKLDNTAS 561
            K +       + L VEPGYPR+IL+D+MGC+    +R K+R  PQDDVDI++ +++   
Sbjct: 1456YKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPG 1635

Query: 562 TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +V A+A+VIPCIL+LC+LVLVYT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1636SVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV 1776
>dbj|AB021226.1|AB021226 Mus musculus mRNA for membrane-type-5 matrix metalloproteinase,
           complete cds
          Length = 4246

 Score =  763 bits (1969), Expect = 0.0
 Identities = 362/574 (63%), Positives = 432/574 (75%), Gaps = 2/574 (0%)
 Frame = +3

Query: 37  AEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWM 96
           A+  F  + WL+ YGYL P + R S L S + +QSA++ MQQFYGI +TG +D+ TI+WM
Sbjct: 216 ADAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWM 395

Query: 97  KKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
           KKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKVG+ +TRKAIR+AF
Sbjct: 396 KKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF 569

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
           DVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEGGFLAHAYFPGPGI
Sbjct: 570 DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI 749

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
           GGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYMET NF
Sbjct: 750 GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF 929

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
           KLP DDLQGIQKIYG                  R   P+                    S
Sbjct: 930 KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERHPRPPRPPLGDRPS 1106

Query: 337 YPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDA 396
            PGAKPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI  FW+GLP  IDA
Sbjct: 1107TPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDA 1286

Query: 397 VYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+A+ WE VGKTYFF
Sbjct: 1287AYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFF 1466

Query: 457 KGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKM 515
           KG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF K +       + 
Sbjct: 1467KGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQK 1646

Query: 516 LRVEPGYPRSILKDFMGC-DGPTDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCIL 574
           L VEPGYPR+IL+D+MGC     +R K+R  PQDDVDI++ +D+   +V A+A+V+PC L
Sbjct: 1647LSVEPGYPRNILRDWMGCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTL 1826

Query: 575 ALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +LCLLVL+YT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1827SLCLLVLLYTIFQFKNKAGPQPVTYYKRPVQEWV 1928
>ref|NM_031757.1| Rattus norvegicus matrix metalloproteinase 24 (membrane-inserted)
           (Mmp24), mRNA
          Length = 4245

 Score =  762 bits (1967), Expect = 0.0
 Identities = 362/574 (63%), Positives = 432/574 (75%), Gaps = 2/574 (0%)
 Frame = +3

Query: 37  AEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWM 96
           A+  F  + WL+ YGYL P + R S L S + +QSA++ MQQFYGI +TG +D+ TI+WM
Sbjct: 243 ADAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWM 422

Query: 97  KKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
           KKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKVG+ +TRKAIR+AF
Sbjct: 423 KKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF 596

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
           DVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEGGFLAHAYFPGPGI
Sbjct: 597 DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI 776

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
           GGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYMET NF
Sbjct: 777 GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF 956

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
           KLP DDLQGIQKIYG                  R   P+                    S
Sbjct: 957 KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERQPRPPRPPLGDRPS 1133

Query: 337 YPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDA 396
            PGAKPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI  FW+GLP  IDA
Sbjct: 1134TPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDA 1313

Query: 397 VYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+A+ WE VGKTYFF
Sbjct: 1314AYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFF 1493

Query: 457 KGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKM 515
           KG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF K +       + 
Sbjct: 1494KGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQK 1673

Query: 516 LRVEPGYPRSILKDFMGC-DGPTDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCIL 574
           L VEPGYPR+IL+D+MGC     +R K+R  PQDDVDI++ +D+   +V A+A+V+PC L
Sbjct: 1674LSVEPGYPRNILRDWMGCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTL 1853

Query: 575 ALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +LCLLVL+YT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1854SLCLLVLLYTIFQFKNKTGPQPVTYYKRPVQEWV 1955
>dbj|AB023659.1|AB023659 Rattus norvegicus mt5-mmp mRNA for membrane-type matrix
           metalloproteinase 5, complete cds
          Length = 4245

 Score =  762 bits (1967), Expect = 0.0
 Identities = 362/574 (63%), Positives = 432/574 (75%), Gaps = 2/574 (0%)
 Frame = +3

Query: 37  AEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWM 96
           A+  F  + WL+ YGYL P + R S L S + +QSA++ MQQFYGI +TG +D+ TI+WM
Sbjct: 243 ADAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWM 422

Query: 97  KKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
           KKPRCGVPD    S +   R KRYALTGQKW+ KHI YSI N TPKVG+ +TRKAIR+AF
Sbjct: 423 KKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF 596

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
           DVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEGGFLAHAYFPGPGI
Sbjct: 597 DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI 776

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
           GGDTHFDSDEPWTLGN NHDGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYMET NF
Sbjct: 777 GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF 956

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
           KLP DDLQGIQKIYG                  R   P+                    S
Sbjct: 957 KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS-ERKHERQPRPPRPPLGDRPS 1133

Query: 337 YPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDA 396
            PGAKPNICDGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI  FW+GLP  IDA
Sbjct: 1134TPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDA 1313

Query: 397 VYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE ++G FVFFK +K+WVFK+ T++PGYPH L  LGS +P  GID+A+ WE VGKTYFF
Sbjct: 1314AYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFF 1493

Query: 457 KGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKM 515
           KG+RYWRY EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF K +       + 
Sbjct: 1494KGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQK 1673

Query: 516 LRVEPGYPRSILKDFMGC-DGPTDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCIL 574
           L VEPGYPR+IL+D+MGC     +R K+R  PQDDVDI++ +D+   +V A+A+V+PC L
Sbjct: 1674LSVEPGYPRNILRDWMGCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTL 1853

Query: 575 ALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +LCLLVL+YT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1854SLCLLVLLYTIFQFKNKTGPQPVTYYKRPVQEWV 1955
>ref|NM_010808.1| Mus musculus matrix metalloproteinase 24 (Mmp24), mRNA
          Length = 2202

 Score =  753 bits (1943), Expect = 0.0
 Identities = 358/566 (63%), Positives = 426/566 (75%), Gaps = 3/566 (0%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL+ YGYL P + R S L S + +QSA++ MQQFYGI +TG +D+ TI+WMKKPRCGVPD
Sbjct: 244 WLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPD 423

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S +   R KRYALTGQKW+ KHI YSI N TPKVG+ +TRKAIR+AFDVWQ VTPL
Sbjct: 424 HPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPL 597

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
           TFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD
Sbjct: 598 TFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 777

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           EPWTLGN NHDGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYMET NFKLP DDLQG
Sbjct: 778 EPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQG 957

Query: 286 IQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNIC 345
           IQKIYG                  R   P+                    S PGAKPNIC
Sbjct: 958 IQKIYGPPAEPSGATRPLPTLPVRRIHSPS--EKKHERHPRPPRRPWGRPSTPGAKPNIC 1131

Query: 346 DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNF 405
           DGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI  FW+GLP  IDA YE ++G F
Sbjct: 1132DGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRF 1311

Query: 406 VFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHG-IDSAIWWEDVGKTYFFKGDRYWRY 464
           VFFK +K+WVFK+ T++PGYPH L  LGS +P  G  D+A+ WE VGKTYFFKG+RYWRY
Sbjct: 1312VFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGKPDTALRWEPVGKTYFFKGERYWRY 1491

Query: 465 GEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYP 523
            EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF K +       + L VEPGYP
Sbjct: 1492SEERRATDPGYPKPITVWKGIPQAPQGAFLSKEGYYTYFYKGRDYWKFDNQKLSVEPGYP 1671

Query: 524 RSILKDFMGC-DGPTDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLV 582
           R+IL+D+MGC     +R K+R  PQDDVDI++ +D+   +V A+A+V+PC L+LCL VL+
Sbjct: 1672RNILRDWMGCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLRVLL 1851

Query: 583 YTVFQFKREGTPRHILYCKRSMQEWV 608
           YT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1852YTIFQFKNKAGPQPVTYYKRPVQEWV 1929
>emb|AJ010262.1|MMU010262 Mus musculus mRNA for membrane-type matrix metalloproteinase 5
          Length = 2202

 Score =  753 bits (1943), Expect = 0.0
 Identities = 358/566 (63%), Positives = 426/566 (75%), Gaps = 3/566 (0%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL+ YGYL P + R S L S + +QSA++ MQQFYGI +TG +D+ TI+WMKKPRCGVPD
Sbjct: 244 WLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPD 423

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S +   R KRYALTGQKW+ KHI YSI N TPKVG+ +TRKAIR+AFDVWQ VTPL
Sbjct: 424 HPHLSRRR--RNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPL 597

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
           TFEEVPY E+++ +++ DI I FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD
Sbjct: 598 TFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 777

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           EPWTLGN NHDGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYMET NFKLP DDLQG
Sbjct: 778 EPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQG 957

Query: 286 IQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNIC 345
           IQKIYG                  R   P+                    S PGAKPNIC
Sbjct: 958 IQKIYGPPAEPSGATRPLPTLPVRRIHSPS--EKKHERHPRPPRRPWGRPSTPGAKPNIC 1131

Query: 346 DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNF 405
           DGNFNT+ + R EMFVFKD+WFWR+RNNRV +GYPMQI  FW+GLP  IDA YE ++G F
Sbjct: 1132DGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRF 1311

Query: 406 VFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHG-IDSAIWWEDVGKTYFFKGDRYWRY 464
           VFFK +K+WVFK+ T++PGYPH L  LGS +P  G  D+A+ WE VGKTYFFKG+RYWRY
Sbjct: 1312VFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGKPDTALRWEPVGKTYFFKGERYWRY 1491

Query: 465 GEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEPGYP 523
            EE R+ DPGYPKPIT+WKGIP++PQGAF+ KE  +TYF K +       + L VEPGYP
Sbjct: 1492SEERRATDPGYPKPITVWKGIPQAPQGAFLSKEGYYTYFYKGRDYWKFDNQKLSVEPGYP 1671

Query: 524 RSILKDFMGC-DGPTDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLV 582
           R+IL+D+MGC     +R K+R  PQDDVDI++ +D+   +V A+A+V+PC L+LCL VL+
Sbjct: 1672RNILRDWMGCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLRVLL 1851

Query: 583 YTVFQFKREGTPRHILYCKRSMQEWV 608
           YT+FQFK +  P+ + Y KR +QEWV
Sbjct: 1852YTIFQFKNKAGPQPVTYYKRPVQEWV 1929
>ref|NM_022564.1| Homo sapiens matrix metalloproteinase 16 (membrane-inserted)
           (MMP16), transcript variant 2, mRNA
          Length = 1644

 Score =  726 bits (1875), Expect = 0.0
 Identities = 353/409 (86%), Positives = 358/409 (87%)
 Frame = +2

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+L  STG RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 113 MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 292

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKF+IRRKRY
Sbjct: 293 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY 472

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 473 ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR 652

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 653 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 832

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 833 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 1012

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 1013RPLPTVPPHRSIPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1186

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFK 409
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK
Sbjct: 1187VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFK 1333
>dbj|D83647.1|HUMMETALLA Homo sapiens mRNA for metalloproteinase, complete cds
          Length = 1532

 Score =  726 bits (1875), Expect = 0.0
 Identities = 353/409 (86%), Positives = 358/409 (87%)
 Frame = +1

Query: 1   MIVLALSTGSRLDFVSQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRM 60
           MI+L  STG RLDFV  S V FLQT +WILCATVC  EQYFNVEVWLQKYGYLPPTDPRM
Sbjct: 1   MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM 180

Query: 61  SVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY 120
           SVLRSAETMQSA+AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKF+IRRKRY
Sbjct: 181 SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY 360

Query: 121 ALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKR 180
           ALTGQKWQHKHI YSIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKR
Sbjct: 361 ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR 540

Query: 181 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 240
           DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
Sbjct: 541 DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL 720

Query: 241 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXX 300
           FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG         
Sbjct: 721 FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT 900

Query: 301 XXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMF 360
                   HRSIPPA                    SYPGAKPNICDGNFNTL ILRREMF
Sbjct: 901 RPLPTVPPHRSIPPA--DPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMF 1074

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFK 409
           VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS+GNFVFFK
Sbjct: 1075VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFK 1221
>dbj|AB047651.1|AB047651 Oryzias latipes MT5-MMP mRNA for membrane type-5 matrix
           metalloproteinase, complete cds
          Length = 2323

 Score =  707 bits (1826), Expect = 0.0
 Identities = 340/578 (58%), Positives = 417/578 (71%), Gaps = 12/578 (2%)
 Frame = +2

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           +  WL+ YGYL P + + S L   + M SA+AAMQ+FYGI +TG +D  T+ WM  PRCG
Sbjct: 182 IPTWLRNYGYLRPHNNQTSDLEQEKAMHSALAAMQRFYGIPVTGILDETTMQWMWTPRCG 361

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPDQ   S +   R KRYALTGQKW+ K I+YSI N TPKVG  +T++AIR+AF VWQ V
Sbjct: 362 VPDQPHTSRRQ--RNKRYALTGQKWREKKISYSISNYTPKVGQKDTQRAIRQAFSVWQMV 535

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPL+F+EVPY E++   ++ DI I FASGFHGDSSPFDGEGGFLAHAYFPG GIGGDTHF
Sbjct: 536 TPLSFQEVPYSEIKKEGKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGAGIGGDTHF 715

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDD 282
           DSDEPWTLGNP+ DGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYM+T +F+LP DD
Sbjct: 716 DSDEPWTLGNPSSDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMDTRDFQLPLDD 895

Query: 283 LQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG-AK 341
           LQGIQKIYG                  R+   +                    + PG  K
Sbjct: 896 LQGIQKIYGVPTAMLEPTRPLPTLPSRRT--HSTSDRKHDRNSRPARPHSDRPALPGNGK 1069

Query: 342 PNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS 401
           PN+CDGNFNT+   RREMFVFKD+WFWR+RNN+V +GYPMQI  FW+GLPP IDA YE S
Sbjct: 1070PNVCDGNFNTVAFFRREMFVFKDRWFWRLRNNKVQEGYPMQIDQFWKGLPPRIDAAYERS 1249

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
           +G FVFFK +KFWVFK+ + +PGYP  L+ LG  +P  GID+A+ WE VGKTYFFKGD+Y
Sbjct: 1250DGKFVFFKGDKFWVFKEVSAEPGYPQSLLELGRSLPKEGIDTALRWEPVGKTYFFKGDQY 1429

Query: 462 WRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGN-STKMLRVEP 520
           WRY EE  ++DPGYPKPI++WKGIPE+PQGAF++++  +TYF K K       + L VEP
Sbjct: 1430WRYNEERSTVDPGYPKPISVWKGIPEAPQGAFINRDGYYTYFYKGKDYWKFDNQKLTVEP 1609

Query: 521 GYPRSILKDFMGCDGPTDRDK-----DRHSPQDDVDIIIKLDNTASTVKAIAIVIPCILA 575
           GYP+SIL+D+MGCD            DR  P D+VDI++ +++  +TV AIA+VIPC+L+
Sbjct: 1610GYPKSILRDWMGCDQSDIEHSGGNRGDRQLPLDNVDIMVTINDVPTTVNAIAVVIPCVLS 1789

Query: 576 LCLLVLVYTVFQFKREGT-----PRHILYCKRSMQEWV 608
           LC+LVLVYT+ QFK +G      P+H  Y K  +QEWV
Sbjct: 1790LCILVLVYTIVQFKNKGVQQNSIPQH--YYKYQVQEWV 1897
>ref|NM_031056.1| Rattus norvegicus matrix metalloproteinase 14, membrane-inserted
           (Mmp14), mRNA
          Length = 2448

 Score =  630 bits (1625), Expect = e-178
 Identities = 309/596 (51%), Positives = 407/596 (67%), Gaps = 3/596 (0%)
 Frame = +2

Query: 16  SQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAA 75
           S+S +L L T    L +        F+ E WLQ+YGYLPP D R    RS +++ +AIAA
Sbjct: 185 SRSLLLPLLTLGTTLASLGWAQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA 364

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+FYG+ +TGK D +T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + 
Sbjct: 365 MQRFYGLQVTGKADSDTMKAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFC 544

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHG 194
           I+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFHG
Sbjct: 545 IQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHG 724

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           DS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGL
Sbjct: 725 DSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGL 904

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           EHSNDP+AIMAPFYQ+M+T+NF LP+DD +GIQ++YG                   S+P 
Sbjct: 905 EHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPD 1084

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNR 374
                                  P   PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+
Sbjct: 1085KPRN-------------------PTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQ 1207

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS 434
           VMDGYPM I  FWRGLP SI+  YE  +G FVFFK +K WVF + +L+PGYP  +  LG 
Sbjct: 1208VMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGR 1387

Query: 435 GIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFV 494
           G+P+  ID+A++W   GKTYFF+G++Y+R+ EE R++D  YPK I +W+GIPESP+G+F+
Sbjct: 1388GLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFM 1567

Query: 495 HKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDII 553
             +  FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   II
Sbjct: 1568GSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVII 1741

Query: 554 IKLDNTAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           I++D   S  V A A+V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1742IEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1909
>emb|X91785.1|RNMTMMPGN R.norvegicus mRNA for membrane-type metalloproteinase
          Length = 2448

 Score =  630 bits (1625), Expect = e-178
 Identities = 309/596 (51%), Positives = 407/596 (67%), Gaps = 3/596 (0%)
 Frame = +2

Query: 16  SQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAA 75
           S+S +L L T    L +        F+ E WLQ+YGYLPP D R    RS +++ +AIAA
Sbjct: 185 SRSLLLPLLTLGTTLASLGWAQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA 364

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+FYG+ +TGK D +T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + 
Sbjct: 365 MQRFYGLQVTGKADSDTMKAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFC 544

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHG 194
           I+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFHG
Sbjct: 545 IQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHG 724

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           DS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGL
Sbjct: 725 DSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGL 904

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           EHSNDP+AIMAPFYQ+M+T+NF LP+DD +GIQ++YG                   S+P 
Sbjct: 905 EHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPD 1084

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNR 374
                                  P   PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+
Sbjct: 1085KPRN-------------------PTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQ 1207

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS 434
           VMDGYPM I  FWRGLP SI+  YE  +G FVFFK +K WVF + +L+PGYP  +  LG 
Sbjct: 1208VMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGR 1387

Query: 435 GIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFV 494
           G+P+  ID+A++W   GKTYFF+G++Y+R+ EE R++D  YPK I +W+GIPESP+G+F+
Sbjct: 1388GLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFM 1567

Query: 495 HKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDII 553
             +  FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   II
Sbjct: 1568GSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVII 1741

Query: 554 IKLDNTAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           I++D   S  V A A+V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1742IEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1909
>gb|U54984.1|MMU54984 Mus musculus membrane-type matrix metalloproteinase 1 mRNA,
           complete cds
          Length = 2583

 Score =  629 bits (1623), Expect = e-178
 Identities = 309/596 (51%), Positives = 407/596 (67%), Gaps = 3/596 (0%)
 Frame = +1

Query: 16  SQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAA 75
           S+S +L L T    L +        F+ E WLQ+YGYLPP D R    RS +++ +AIAA
Sbjct: 268 SRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA 447

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+FYG+ +TGK D  T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + 
Sbjct: 448 MQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFC 627

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHG 194
           I+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFHG
Sbjct: 628 IQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHG 807

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           DS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGL
Sbjct: 808 DSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGL 987

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           EHSNDP+AIM+PFYQ+M+T+NF LP+DD +GIQ++YG                   S+P 
Sbjct: 988 EHSNDPSAIMSPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPD 1167

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNR 374
                                  P   PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+
Sbjct: 1168KPKN-------------------PAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQ 1290

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS 434
           VMDGYPM I  FWRGLP SI+  YE  +G FVFFK +K WVF + +L+PGYP  +  LG 
Sbjct: 1291VMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGR 1470

Query: 435 GIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFV 494
           G+P+  ID+A++W   GKTYFF+G++Y+R+ EE R++D  YPK I +W+GIPESP+G+F+
Sbjct: 1471GLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFM 1650

Query: 495 HKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDII 553
             +  FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+ R  D  + ++   II
Sbjct: 1651GSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGRRPDEGTEEETEVII 1824

Query: 554 IKLDNTAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           I++D   S  V A A+V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1825IEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1992
>ref|NM_004995.2| Homo sapiens matrix metalloproteinase 14 (membrane-inserted)
           (MMP14), mRNA
          Length = 3558

 Score =  627 bits (1617), Expect = e-177
 Identities = 302/571 (52%), Positives = 397/571 (68%), Gaps = 3/571 (0%)
 Frame = +1

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 331 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPR 510

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 511 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWE 690

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 691 SATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 870

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHS+DP+AIMAPFYQ+M+T+NF LP
Sbjct: 871 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLP 1050

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 1051DDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVP-------------------DKPKNPT 1173

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 1174YGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1353

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1354RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1533

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1534KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1713

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P+    D  + ++   III++D      V A A+V+P +L L 
Sbjct: 1714EPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLL 1887

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 1888VLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 1980
>gb|U41078.1|HSU41078 Human membrane-type matrix metalloproteinase-1 mRNA, complete cds
          Length = 1749

 Score =  627 bits (1617), Expect = e-177
 Identities = 302/571 (52%), Positives = 397/571 (68%), Gaps = 3/571 (0%)
 Frame = +1

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 97  FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPR 276

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 277 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWE 456

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 457 SATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 636

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHS+DP+AIMAPFYQ+M+T+NF LP
Sbjct: 637 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLP 816

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 817 DDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVP-------------------DKPKNPT 939

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 940 YGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1119

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1120RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1299

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1300KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1479

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P+    D  + ++   III++D      V A A+V+P +L L 
Sbjct: 1480EPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLL 1653

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 1654VLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 1746
>emb|Z48481.1|HSMMPM1 H.sapiens mRNA for membrane-type matrix metalloproteinase 1
          Length = 3437

 Score =  627 bits (1617), Expect = e-177
 Identities = 302/571 (52%), Positives = 397/571 (68%), Gaps = 3/571 (0%)
 Frame = +3

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 210 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPR 389

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 390 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWE 569

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 570 SATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 749

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHS+DP+AIMAPFYQ+M+T+NF LP
Sbjct: 750 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLP 929

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 930 DDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVP-------------------DKPKNPT 1052

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 1053YGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1232

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1233RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1412

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1413KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1592

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P+    D  + ++   III++D      V A A+V+P +L L 
Sbjct: 1593EPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLL 1766

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 1767VLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 1859
>emb|X83535.1|HSMTMMP29 Homo sapiens mRNA for membrane-type matrix metalloproteinase
          Length = 2365

 Score =  627 bits (1617), Expect = e-177
 Identities = 302/571 (52%), Positives = 397/571 (68%), Gaps = 3/571 (0%)
 Frame = +3

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 216 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPR 395

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 396 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWE 575

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 576 SATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 755

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHS+DP+AIMAPFYQ+M+T+NF LP
Sbjct: 756 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLP 935

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 936 DDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVP-------------------DKPKNPT 1058

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 1059YGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1238

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1239RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1418

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1419KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1598

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P+    D  + ++   III++D      V A A+V+P +L L 
Sbjct: 1599EPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLL 1772

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 1773VLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 1865
>dbj|AB010921.1|AB010921 Capra hircus MT1MMP mRNA for Membrane-type matrix
           metalloproteinase-1, complete cds
          Length = 1798

 Score =  627 bits (1616), Expect = e-177
 Identities = 302/580 (52%), Positives = 400/580 (68%), Gaps = 3/580 (0%)
 Frame = +2

Query: 32  ATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRN 91
           A++  A+  F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +
Sbjct: 95  ASLSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQRFYGLRVTGKADAD 274

Query: 92  TIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKA 151
           T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +A
Sbjct: 275 TMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATFEA 454

Query: 152 IRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAY 210
           IR+AF VW++ TPL F EVPY  +  G ++  D+ I FA GFHGDS+PFDGEGGFLAHAY
Sbjct: 455 IRKAFRVWESATPLRFREVPYAYIREGHEKQADVMIFFAEGFHGDSTPFDGEGGFLAHAY 634

Query: 211 FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQY 270
           FPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+
Sbjct: 635 FPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQW 814

Query: 271 METDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXX 330
           M+T+NF LP+DD +GIQ++YG                   SIP                 
Sbjct: 815 MDTENFVLPDDDRRGIQQLYGSKSGSPTKIPPQPRTTSRPSIPDKPKN------------ 958

Query: 331 XXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGL 390
                  P   PNICDGNF+T+ +LR EMFVFK++WFWRVR N+VMDGYPM I  FWRGL
Sbjct: 959 -------PTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWRGL 1117

Query: 391 PPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDV 450
           P SI+  YE  +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   
Sbjct: 1118PASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPS 1297

Query: 451 GKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKST 509
           GKTYFF+G++Y+R+ EE+R ++  YPK I +W+GIPESP+G+F+  +  FTYF K  K  
Sbjct: 1298GKTYFFRGNKYYRFNEELRIVESEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYW 1477

Query: 510 GNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNTAS-TVKAIAI 568
             + + L+VEPGYP+S L+D+MGC   +    D  + ++   III++D   S  V A A+
Sbjct: 1478KFNNQKLKVEPGYPKSALRDWMGCPS-SGGQPDEGTEEETEVIIIEVDEEGSGAVSAAAV 1654

Query: 569 VIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1655VLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1774
>emb|X83537.1|RNMTMMP Rattus norvegicus mRNA for membrane-type matrix metalloproteinase
          Length = 2412

 Score =  626 bits (1615), Expect = e-177
 Identities = 307/596 (51%), Positives = 406/596 (67%), Gaps = 3/596 (0%)
 Frame = +2

Query: 16  SQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAA 75
           S+S +L L T    L +        F+ E WLQ+YGYLPP D R    RS +++ +AIAA
Sbjct: 194 SRSLLLPLLTLGTTLASLGWAQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA 373

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           +Q+FYG+ +TGK D +T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + 
Sbjct: 374 IQRFYGLQVTGKADSDTMKAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFC 553

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHG 194
           I+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFHG
Sbjct: 554 IQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHG 733

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           DS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGL
Sbjct: 734 DSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGL 913

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           EHSNDP+ IMAPFYQ+M+T+NF LP+DD +GIQ++YG                   S+P 
Sbjct: 914 EHSNDPSDIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPD 1093

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNR 374
                                  P   PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+
Sbjct: 1094KPRN-------------------PTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQ 1216

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS 434
           VMDGYPM I  FWRGLP SI+  YE  +G FVFFK +K WVF + +L+PGYP  +  LG 
Sbjct: 1217VMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGR 1396

Query: 435 GIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFV 494
           G+P+  ID+A++W   GKTYFF+G++Y+R+ EE R++D  YPK I +W+GIPESP+G+F+
Sbjct: 1397GLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFM 1576

Query: 495 HKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDII 553
             +  FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   II
Sbjct: 1577GSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVII 1750

Query: 554 IKLDNTAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           I++D   S  V A A+V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1751IEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1918
>dbj|D26512.1|HUMMTMMP Human mRNA for membrane type matrix metalloproteinase, comlete cds
          Length = 3403

 Score =  626 bits (1614), Expect = e-177
 Identities = 302/571 (52%), Positives = 396/571 (68%), Gaps = 3/571 (0%)
 Frame = +1

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 208 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPR 387

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 388 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWE 567

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 568 SATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 747

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHS+DP+AIMAPFYQ+M+T+NF LP
Sbjct: 748 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLP 927

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 928 DDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVP-------------------DKPKNPT 1050

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK +WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 1051YGPNICDGNFDTVAMLRGEMFVFKKRWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1230

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1231RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1410

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1411KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1590

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P+    D  + ++   III++D      V A A+V+P +L L 
Sbjct: 1591EPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLL 1764

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 1765VLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 1857
>emb|X90925.1|HSMTMMPPR H.sapiens mRNA for MT-MMP protein
          Length = 2369

 Score =  625 bits (1612), Expect = e-177
 Identities = 301/571 (52%), Positives = 396/571 (68%), Gaps = 3/571 (0%)
 Frame = +2

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 209 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPR 388

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 389 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWE 568

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 569 SATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 748

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHS+DP+AIMAPFYQ+M+T+NF LP
Sbjct: 749 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLP 928

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 929 DDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVP-------------------DKPKNPT 1051

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 1052YGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1231

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1232RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1411

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1412KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1591

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+  L+D+MGC  P+    D  + ++   III++D      V A A+V+P +L L 
Sbjct: 1592EPGYPKPALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLL 1765

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 1766VLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 1858
>gb|AF067419.1|AF067419 Sus scrofa membrane-type 1 matrix metalloproteinase (MT1-MMP) mRNA,
           complete cds
          Length = 3284

 Score =  622 bits (1605), Expect = e-176
 Identities = 301/573 (52%), Positives = 396/573 (68%), Gaps = 3/573 (0%)
 Frame = +1

Query: 39  QYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKK 98
           Q F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++
Sbjct: 85  QSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQRFYGLRVTGKADADTMKAMRR 264

Query: 99  PRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDV 158
           PRCGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF V
Sbjct: 265 PRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRV 444

Query: 159 WQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG 217
           W++ TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IG
Sbjct: 445 WESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIG 624

Query: 218 GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFK 277
           GDTHFDS EPWT+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+M+T+NF 
Sbjct: 625 GDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFV 804

Query: 278 LPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSY 337
           LP+DD +GIQ++YG                   S+P                        
Sbjct: 805 LPDDDRRGIQQLYGSESGFPTKMPPQPRTTSKPSVP-------------------DKPKN 927

Query: 338 PGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
           P   PNICDGNF+T+ +LR EMFVFK++WFWRVR N+VMDGYPM I  FWRGLP SI+  
Sbjct: 928 PTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWRGLPASINTA 1107

Query: 398 YENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
           YE  +G FVFFK +K WVF + +L+PGYP  +  LG  +P+  ID+A++W   GK YFF+
Sbjct: 1108YERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRRLPTDKIDAALFWMPNGKDYFFR 1287

Query: 458 GDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKML 516
           G++Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L
Sbjct: 1288GNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKL 1467

Query: 517 RVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNTAS-TVKAIAIVIPCILA 575
           +VEPGYP+S L+D+MGC  P+    D  + ++   III++D   S  V A A+V+P +L 
Sbjct: 1468KVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLL 1641

Query: 576 LCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1642LLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1740
>gb|AF290429.1|AF290429 Bos taurus membrane-type matrix metalloprotease 1 mRNA, complete
           cds
          Length = 1805

 Score =  622 bits (1605), Expect = e-176
 Identities = 300/580 (51%), Positives = 399/580 (68%), Gaps = 3/580 (0%)
 Frame = +3

Query: 32  ATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRN 91
           A++  A+  F+ E WLQ++GYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +
Sbjct: 123 ASLSSAQSSFSPEAWLQQHGYLPPGDLRTHTQRSPQSLSAAIAAMQRFYGLRVTGKADAD 302

Query: 92  TIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKA 151
           T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + I+N TP VG+  T +A
Sbjct: 303 TMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPNVGEYATFEA 482

Query: 152 IRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAY 210
           IR+AF VW++ TPL F EVPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAY
Sbjct: 483 IRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAY 662

Query: 211 FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQY 270
           FPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+
Sbjct: 663 FPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQW 842

Query: 271 METDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXX 330
           M+T+NF LP+DD +GIQ++YG                   S+P                 
Sbjct: 843 MDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKN------------ 986

Query: 331 XXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGL 390
                  P   PNICDGNF+T+ +LR EMFVFK++WFWRVR N+VMDGYPM I  FWRGL
Sbjct: 987 -------PTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWRGL 1145

Query: 391 PPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDV 450
           P SI+  YE  +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   
Sbjct: 1146PASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPN 1325

Query: 451 GKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKST 509
           GKTYFF+G++Y+R+ EE+R ++  YPK I +W+GIPESP+G+F+  +  FTYF K  K  
Sbjct: 1326GKTYFFRGNKYYRFNEELRIVESEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYW 1505

Query: 510 GNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNTAS-TVKAIAI 568
             + + L+VEPGYP+S L+D+MGC   +    D  + ++   III++D   S  V A A+
Sbjct: 1506KFNNQKLKVEPGYPKSALRDWMGCPS-SGGQPDEGTEEETEVIIIEVDEEGSGAVSAAAV 1682

Query: 569 VIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1683VLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1802
>gb|AF306662.2|AF306662 Cricetulus griseus matrix metalloprotease MT1-MMP (MMP14) mRNA,
           complete cds
          Length = 1927

 Score =  621 bits (1602), Expect = e-176
 Identities = 299/571 (52%), Positives = 397/571 (69%), Gaps = 3/571 (0%)
 Frame = +2

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +A+AAMQ+FYG+ +TGK D +T+  MK+PR
Sbjct: 275 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAVAAMQRFYGLQVTGKADLDTMKAMKRPR 454

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 455 CGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWE 634

Query: 161 NVTPLTFEEVPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EVPY  +  G ++  DI I+FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 635 SATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 814

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+M+T+NF LP
Sbjct: 815 THFDSAEPWTVQNEDLNGNDVFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLP 994

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                   S+P                        P 
Sbjct: 995 DDDRRGIQQLYGSKSGSPTKMPPQPRTTSWPSVPDKPRN-------------------PT 1117

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VM GYPM I  FWRGLP S++  YE
Sbjct: 1118YGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMVGYPMPIGQFWRGLPASMNTAYE 1297

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1298RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1477

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1478KYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1657

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNT-ASTVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P+    D  + ++   III++D      V A A+++P +L + 
Sbjct: 1658EPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDEEGGGAVNAAAVLLPVLLLVL 1831

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +LV+   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1832VLVVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1924
>gb|BC006412.1|BC006412 Homo sapiens, matrix metalloproteinase 15 (membrane-inserted),
           clone MGC:10773 IMAGE:3607064, mRNA, complete cds
          Length = 3458

 Score =  617 bits (1590), Expect = e-174
 Identities = 304/618 (49%), Positives = 397/618 (64%), Gaps = 51/618 (8%)
 Frame = +2

Query: 42  NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           + E WL+ YGYLP     MS +RSA+ + SA+A MQ+FYGI +TG +D  T +WMK+PRC
Sbjct: 59  HAENWLRLYGYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRC 238

Query: 102 GVPDQTRGSSKFNIRR--KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           GVPDQ     K N+RR  KRYALTG+KW + H+ +SI+N T K+G   + +A+RRAF VW
Sbjct: 239 GVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVW 418

Query: 160 QNVTPLTFEEVPYIELE-NGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGG 218
           +  TPL F+EVPY ++    +++ DI ++FASGFHGDSSPFDG GGFLAHAYFPGPG+GG
Sbjct: 419 EQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGG 598

Query: 219 DTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKL 278
           DTHFD+DEPWT  + +  GN+LFLVAVHELGHALGLEHS++P AIMAPFYQ+ + DNFKL
Sbjct: 599 DTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKL 778

Query: 279 PNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR------------SIPPAXXXXXXXXXXX 326
           P DDL+GIQ++YG                  R              PP            
Sbjct: 779 PEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPG 958

Query: 327 XXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYF 386
                          PNICDG+F+T+ +LR EMFVFK +WFWRVR+NRV+D YPM I +F
Sbjct: 959 PPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHF 1138

Query: 387 WRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIW 446
           WRGLP  I A YE  +G FVFFK +++W+F++  L+PGYP  L + G GIP   ID+AIW
Sbjct: 1139WRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIW 1318

Query: 447 WEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK- 505
           WE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP SP+GAF+  +  +TYF K 
Sbjct: 1319WEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKG 1498

Query: 506 EKSTGNSTKMLRVEPGYPRSILKDFMGCD-----GPTDRDKDR-------------HSPQ 547
            K      + LR+EPGYP+SIL+DFMGC      GP   D  R              S +
Sbjct: 1499TKYWKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAE 1678

Query: 548 DDVD-----------------IIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR 590
            DV                  ++++++  A TV  + +++P +L LC+L L Y + Q +R
Sbjct: 1679GDVGDGDGDFGAGVNKDRGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQR 1858

Query: 591 EGTPRHILYCKRSMQEWV 608
           +G PR +LYCKRS+QEWV
Sbjct: 1859KGAPRVLLYCKRSLQEWV 1912
>ref|NM_002428.1| Homo sapiens matrix metalloproteinase 15 (membrane-inserted)
           (MMP15), mRNA
          Length = 3530

 Score =  617 bits (1590), Expect = e-174
 Identities = 304/618 (49%), Positives = 397/618 (64%), Gaps = 51/618 (8%)
 Frame = +1

Query: 42  NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           + E WL+ YGYLP     MS +RSA+ + SA+A MQ+FYGI +TG +D  T +WMK+PRC
Sbjct: 202 HAENWLRLYGYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRC 381

Query: 102 GVPDQTRGSSKFNIRR--KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           GVPDQ     K N+RR  KRYALTG+KW + H+ +SI+N T K+G   + +A+RRAF VW
Sbjct: 382 GVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVW 561

Query: 160 QNVTPLTFEEVPYIELE-NGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGG 218
           +  TPL F+EVPY ++    +++ DI ++FASGFHGDSSPFDG GGFLAHAYFPGPG+GG
Sbjct: 562 EQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGG 741

Query: 219 DTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKL 278
           DTHFD+DEPWT  + +  GN+LFLVAVHELGHALGLEHS++P AIMAPFYQ+ + DNFKL
Sbjct: 742 DTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKL 921

Query: 279 PNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR------------SIPPAXXXXXXXXXXX 326
           P DDL+GIQ++YG                  R              PP            
Sbjct: 922 PEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPG 1101

Query: 327 XXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYF 386
                          PNICDG+F+T+ +LR EMFVFK +WFWRVR+NRV+D YPM I +F
Sbjct: 1102PPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHF 1281

Query: 387 WRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIW 446
           WRGLP  I A YE  +G FVFFK +++W+F++  L+PGYP  L + G GIP   ID+AIW
Sbjct: 1282WRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIW 1461

Query: 447 WEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK- 505
           WE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP SP+GAF+  +  +TYF K 
Sbjct: 1462WEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKG 1641

Query: 506 EKSTGNSTKMLRVEPGYPRSILKDFMGCD-----GPTDRDKDR-------------HSPQ 547
            K      + LR+EPGYP+SIL+DFMGC      GP   D  R              S +
Sbjct: 1642TKYWKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAE 1821

Query: 548 DDVD-----------------IIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR 590
            DV                  ++++++  A TV  + +++P +L LC+L L Y + Q +R
Sbjct: 1822GDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQR 2001

Query: 591 EGTPRHILYCKRSMQEWV 608
           +G PR +LYCKRS+QEWV
Sbjct: 2002KGAPRVLLYCKRSLQEWV 2055
>emb|Z48482.1|HSMMPM2 H.sapiens mRNA for membrane-type matrix metalloproteinase 2
          Length = 3530

 Score =  617 bits (1590), Expect = e-174
 Identities = 304/618 (49%), Positives = 397/618 (64%), Gaps = 51/618 (8%)
 Frame = +1

Query: 42  NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           + E WL+ YGYLP     MS +RSA+ + SA+A MQ+FYGI +TG +D  T +WMK+PRC
Sbjct: 202 HAENWLRLYGYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRC 381

Query: 102 GVPDQTRGSSKFNIRR--KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           GVPDQ     K N+RR  KRYALTG+KW + H+ +SI+N T K+G   + +A+RRAF VW
Sbjct: 382 GVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVW 561

Query: 160 QNVTPLTFEEVPYIELE-NGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGG 218
           +  TPL F+EVPY ++    +++ DI ++FASGFHGDSSPFDG GGFLAHAYFPGPG+GG
Sbjct: 562 EQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGG 741

Query: 219 DTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKL 278
           DTHFD+DEPWT  + +  GN+LFLVAVHELGHALGLEHS++P AIMAPFYQ+ + DNFKL
Sbjct: 742 DTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKL 921

Query: 279 PNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR------------SIPPAXXXXXXXXXXX 326
           P DDL+GIQ++YG                  R              PP            
Sbjct: 922 PEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPG 1101

Query: 327 XXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYF 386
                          PNICDG+F+T+ +LR EMFVFK +WFWRVR+NRV+D YPM I +F
Sbjct: 1102PPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHF 1281

Query: 387 WRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIW 446
           WRGLP  I A YE  +G FVFFK +++W+F++  L+PGYP  L + G GIP   ID+AIW
Sbjct: 1282WRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIW 1461

Query: 447 WEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK- 505
           WE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP SP+GAF+  +  +TYF K 
Sbjct: 1462WEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKG 1641

Query: 506 EKSTGNSTKMLRVEPGYPRSILKDFMGCD-----GPTDRDKDR-------------HSPQ 547
            K      + LR+EPGYP+SIL+DFMGC      GP   D  R              S +
Sbjct: 1642TKYWKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAE 1821

Query: 548 DDVD-----------------IIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR 590
            DV                  ++++++  A TV  + +++P +L LC+L L Y + Q +R
Sbjct: 1822GDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQR 2001

Query: 591 EGTPRHILYCKRSMQEWV 608
           +G PR +LYCKRS+QEWV
Sbjct: 2002KGAPRVLLYCKRSLQEWV 2055
>ref|NM_008609.1| Mus musculus matrix metalloproteinase 15 (Mmp15), mRNA
          Length = 3339

 Score =  615 bits (1585), Expect = e-174
 Identities = 301/630 (47%), Positives = 403/630 (63%), Gaps = 54/630 (8%)
 Frame = +2

Query: 33  TVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNT 92
           T  K  + +  E WL+ YGYLP     MS +RSA+ + SA+A MQ FYGI +TG +D  T
Sbjct: 143 TASKDAEVYAAENWLRLYGYLPQPSRHMSTMRSAQILASALAEMQSFYGIPVTGVLDEET 322

Query: 93  IDWMKKPRCGVPDQTRGSSKFNIRR--KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRK 150
             WMK+PRCGVPDQ     K N+RR  KRY LTG+ W + H+ +SI+N T K+G   + +
Sbjct: 323 KTWMKRPRCGVPDQFGVHVKANLRRRRKRYTLTGKAWNNYHLTFSIQNYTEKLGWYNSME 502

Query: 151 AIRRAFDVWQNVTPLTFEEVPYIELENGKR-DVDITIIFASGFHGDSSPFDGEGGFLAHA 209
           A+RRAF VW+ VTPL F+EV Y ++   +R + DI ++FASGFHGDSSPFDG GGFLAHA
Sbjct: 503 AVRRAFQVWEQVTPLVFQEVSYDDIRLRRRAEADIMVLFASGFHGDSSPFDGVGGFLAHA 682

Query: 210 YFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ 269
           YFPGPG+GGDTHFD+DEPWT  + +  G  LFLVAVHELGHALGLEHS++P+AIMAPFYQ
Sbjct: 683 YFPGPGLGGDTHFDADEPWTFSSTDLHGISLFLVAVHELGHALGLEHSSNPSAIMAPFYQ 862

Query: 270 YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXX 329
           +M+TDNF+LP DDL+GIQ++YG                  R   P               
Sbjct: 863 WMDTDNFQLPEDDLRGIQQLYGSPDGKPQPTRPLPTVRPRRPGRP-----------DHQP 1009

Query: 330 XXXXXXSYPGAKP-----------------------NICDGNFNTLVILRREMFVFKDQW 366
                  +PG KP                       NICDGNF+T+ +LR EMFVFK +W
Sbjct: 1010PRPPQPPHPGGKPERPPKPGPPPQPRATERPDQYGPNICDGNFDTVAVLRGEMFVFKGRW 1189

Query: 367 FWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYP 426
           FWRVR+NRV+D YPM I +FWRGLP +I A YE  +G+FVFFK N++W+F++  L+PGYP
Sbjct: 1190FWRVRHNRVLDNYPMPIGHFWRGLPGNISAAYERQDGHFVFFKGNRYWLFREANLEPGYP 1369

Query: 427 HDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIP 486
             L + G+ IP   ID+AIWWE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP
Sbjct: 1370QPLSSYGTDIPYDRIDTAIWWEPTGHTFFFQADRYWRFNEETQHGDPGYPKPISVWQGIP 1549

Query: 487 ESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGC------------ 533
            SP+GAF+  +  +TYF K  K    + + LR+EPG+P+SIL+DFMGC            
Sbjct: 1550TSPKGAFLSNDAAYTYFYKGTKYWKFNNERLRMEPGHPKSILRDFMGCQEHVEPRSRWPD 1729

Query: 534 --------DGPTDRDKDRHSPQDDVD-------IIIKLDNTASTVKAIAIVIPCILALCL 578
                   +G  + + D  S +++         ++++++    TV  + +++P +L LC+
Sbjct: 1730VARPPFNPNGGAEPEADGDSKEENAGDKDEGSRVVVQMEEVVRTVNVVMVLVPLLLLLCI 1909

Query: 579 LVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           L L + + Q +R+G PR +LYCKRS+QEWV
Sbjct: 1910LGLAFALVQMQRKGAPRMLLYCKRSLQEWV 1999
>dbj|D86332.1|D86332 Mus musculus mRNA for membrane type-2 matrix metalloproteinase,
           complete cds
          Length = 3339

 Score =  615 bits (1585), Expect = e-174
 Identities = 301/630 (47%), Positives = 403/630 (63%), Gaps = 54/630 (8%)
 Frame = +2

Query: 33  TVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNT 92
           T  K  + +  E WL+ YGYLP     MS +RSA+ + SA+A MQ FYGI +TG +D  T
Sbjct: 143 TASKDAEVYAAENWLRLYGYLPQPSRHMSTMRSAQILASALAEMQSFYGIPVTGVLDEET 322

Query: 93  IDWMKKPRCGVPDQTRGSSKFNIRR--KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRK 150
             WMK+PRCGVPDQ     K N+RR  KRY LTG+ W + H+ +SI+N T K+G   + +
Sbjct: 323 KTWMKRPRCGVPDQFGVHVKANLRRRRKRYTLTGKAWNNYHLTFSIQNYTEKLGWYNSME 502

Query: 151 AIRRAFDVWQNVTPLTFEEVPYIELENGKR-DVDITIIFASGFHGDSSPFDGEGGFLAHA 209
           A+RRAF VW+ VTPL F+EV Y ++   +R + DI ++FASGFHGDSSPFDG GGFLAHA
Sbjct: 503 AVRRAFQVWEQVTPLVFQEVSYDDIRLRRRAEADIMVLFASGFHGDSSPFDGVGGFLAHA 682

Query: 210 YFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ 269
           YFPGPG+GGDTHFD+DEPWT  + +  G  LFLVAVHELGHALGLEHS++P+AIMAPFYQ
Sbjct: 683 YFPGPGLGGDTHFDADEPWTFSSTDLHGISLFLVAVHELGHALGLEHSSNPSAIMAPFYQ 862

Query: 270 YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXX 329
           +M+TDNF+LP DDL+GIQ++YG                  R   P               
Sbjct: 863 WMDTDNFQLPEDDLRGIQQLYGSPDGKPQPTRPLPTVRPRRPGRP-----------DHQP 1009

Query: 330 XXXXXXSYPGAKP-----------------------NICDGNFNTLVILRREMFVFKDQW 366
                  +PG KP                       NICDGNF+T+ +LR EMFVFK +W
Sbjct: 1010PRPPQPPHPGGKPERPPKPGPPPQPRATERPDQYGPNICDGNFDTVAVLRGEMFVFKGRW 1189

Query: 367 FWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYP 426
           FWRVR+NRV+D YPM I +FWRGLP +I A YE  +G+FVFFK N++W+F++  L+PGYP
Sbjct: 1190FWRVRHNRVLDNYPMPIGHFWRGLPGNISAAYERQDGHFVFFKGNRYWLFREANLEPGYP 1369

Query: 427 HDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIP 486
             L + G+ IP   ID+AIWWE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP
Sbjct: 1370QPLSSYGTDIPYDRIDTAIWWEPTGHTFFFQADRYWRFNEETQHGDPGYPKPISVWQGIP 1549

Query: 487 ESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGC------------ 533
            SP+GAF+  +  +TYF K  K    + + LR+EPG+P+SIL+DFMGC            
Sbjct: 1550TSPKGAFLSNDAAYTYFYKGTKYWKFNNERLRMEPGHPKSILRDFMGCQEHVEPRSRWPD 1729

Query: 534 --------DGPTDRDKDRHSPQDDVD-------IIIKLDNTASTVKAIAIVIPCILALCL 578
                   +G  + + D  S +++         ++++++    TV  + +++P +L LC+
Sbjct: 1730VARPPFNPNGGAEPEADGDSKEENAGDKDEGSRVVVQMEEVVRTVNVVMVLVPLLLLLCI 1909

Query: 579 LVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           L L + + Q +R+G PR +LYCKRS+QEWV
Sbjct: 1910LGLAFALVQMQRKGAPRMLLYCKRSLQEWV 1999
>gb|U73940.1|OCU73940 Oryctolagus cuniculus membane-type 1 metalloproteinase precursor
           (MMP-14) mRNA, partial cds
          Length = 1842

 Score =  614 bits (1584), Expect = e-174
 Identities = 297/561 (52%), Positives = 388/561 (68%), Gaps = 3/561 (0%)
 Frame = +1

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 223 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQRFYGLRVTGKADTDTMKAMRRPR 402

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 403 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWE 582

Query: 161 NVTPLTFEEVPYIELENGK-RDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EV Y  + +G+ +  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 583 SATPLRFREVHYAYIRDGREKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 762

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+M+T+NF LP
Sbjct: 763 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLP 942

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD +GIQ++YG                    IP                        P 
Sbjct: 943 DDDRRGIQQLYGSQSGSPTKMPPPPRTTSRTFIPDKPRN-------------------PT 1065

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             PNICDGNF+T+ +LR EMFVFK++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE
Sbjct: 1066YGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYE 1245

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1246RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1425

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1426KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1605

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNTAS-TVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P     D  + ++   III++D   S  V A A+V+P +L L 
Sbjct: 1606EPGYPKSALRDWMGC--PAGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLL 1779

Query: 578 LLVLVYTVFQFKREGTPRHIL 598
           +L +   VF F+R GTP+ +L
Sbjct: 1780VLAVGLAVFFFRRHGTPKRLL 1842
>ref|NM_008608.1| Mus musculus matrix metalloproteinase 14 (membrane-inserted)
           (Mmp14), mRNA
          Length = 2488

 Score =  614 bits (1583), Expect = e-174
 Identities = 304/596 (51%), Positives = 402/596 (67%), Gaps = 3/596 (0%)
 Frame = +2

Query: 16  SQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAA 75
           S+S +L L T    L +        F+ E WLQ+YGYLPP D R    RS +++ +AIAA
Sbjct: 194 SRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA 373

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+FYG+ +TGK D  T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + 
Sbjct: 374 MQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFC 553

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHG 194
           I+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFHG
Sbjct: 554 IQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHG 733

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           DS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGL
Sbjct: 734 DSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGL 913

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           EHSNDP+ IM+PFYQ+M+T+NF LP+DD +GIQ++YG                   S+P 
Sbjct: 914 EHSNDPSDIMSPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPD 1093

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNR 374
                                  P   PNICDGNF+T+ +LR EMFVFK++W WRVRNN+
Sbjct: 1094KPKN-------------------PAYGPNICDGNFDTVAMLRGEMFVFKERWLWRVRNNQ 1216

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS 434
           VMDGYPM I  FWRGLP SI+  YE  +G FVFFK +K WV  + +L+PGY + +  L  
Sbjct: 1217VMDGYPMPIGQFWRGLPASINTAYERKDGTFVFFKGDKHWVCVEASLEPGYANHIKELVR 1396

Query: 435 GIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFV 494
           G+PS  ID+A++W   GKTYFF+G++Y+R+ EE R++D  YPK I +W+GIPESP+G+F+
Sbjct: 1397GLPSDKIDTALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFM 1576

Query: 495 HKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDII 553
             +  FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   II
Sbjct: 1577GSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVII 1750

Query: 554 IKLDNTAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           I++D   S  V A A+V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1751IEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1918
>emb|X83536.2|MMMTMMP Mus musculus mRNA for membrane-type matrix metalloproteinase
          Length = 2488

 Score =  614 bits (1583), Expect = e-174
 Identities = 304/596 (51%), Positives = 402/596 (67%), Gaps = 3/596 (0%)
 Frame = +2

Query: 16  SQSRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAA 75
           S+S +L L T    L +        F+ E WLQ+YGYLPP D R    RS +++ +AIAA
Sbjct: 194 SRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA 373

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+FYG+ +TGK D  T+  M++PRCGVPD+     K N+RRKRYA+ G KWQH  I + 
Sbjct: 374 MQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFC 553

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFHG 194
           I+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFHG
Sbjct: 554 IQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHG 733

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           DS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +GND+FLVAVHELGHALGL
Sbjct: 734 DSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGL 913

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           EHSNDP+ IM+PFYQ+M+T+NF LP+DD +GIQ++YG                   S+P 
Sbjct: 914 EHSNDPSDIMSPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPD 1093

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNR 374
                                  P   PNICDGNF+T+ +LR EMFVFK++W WRVRNN+
Sbjct: 1094KPKN-------------------PAYGPNICDGNFDTVAMLRGEMFVFKERWLWRVRNNQ 1216

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS 434
           VMDGYPM I  FWRGLP SI+  YE  +G FVFFK +K WV  + +L+PGY + +  L  
Sbjct: 1217VMDGYPMPIGQFWRGLPASINTAYERKDGTFVFFKGDKHWVCVEASLEPGYANHIKELVR 1396

Query: 435 GIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFV 494
           G+PS  ID+A++W   GKTYFF+G++Y+R+ EE R++D  YPK I +W+GIPESP+G+F+
Sbjct: 1397GLPSDKIDTALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFM 1576

Query: 495 HKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDII 553
             +  FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   II
Sbjct: 1577GSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVII 1750

Query: 554 IKLDNTAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           I++D   S  V A A+V+P +L L +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1751IEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1918
>gb|U83918.1|OCU83918 Oryctolagus cuniculus membrane type 1 metalloproteinase mRNA,
           complete cds
          Length = 1760

 Score =  611 bits (1575), Expect = e-173
 Identities = 296/571 (51%), Positives = 392/571 (67%), Gaps = 3/571 (0%)
 Frame = +3

Query: 41  FNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPR 100
           F+ E WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+  M++PR
Sbjct: 102 FSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQRFYGLRVTGKADTDTMKAMRRPR 281

Query: 101 CGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           CGVPD+     K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW+
Sbjct: 282 CGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWE 461

Query: 161 NVTPLTFEEVPYIELENGK-RDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
           + TPL F EV Y  + +G+ +  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGD
Sbjct: 462 SATPLRFREVHYAYIRDGREKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGD 641

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           THFDS EPWT+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+M+T+ F LP
Sbjct: 642 THFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTEKFLLP 821

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +D+ +GIQ++YG                   S   +                      P 
Sbjct: 822 DDERRGIQQLYG-------------------SQSGSPTRCLLNPGQPSGLLFRISPGNPT 944

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             P ICDGNF+T+ + R EMFVFK++WFWRVRNN+VMDGYPM I   WRGLP SI+  YE
Sbjct: 945 YGPKICDGNFDTVAVFRGEMFVFKERWFWRVRNNQVMDGYPMPIGQLWRGLPASINTAYE 1124

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
             +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+G+
Sbjct: 1125RKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGN 1304

Query: 460 RYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRV 518
           +Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L+V
Sbjct: 1305KYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKV 1484

Query: 519 EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDNTAS-TVKAIAIVIPCILALC 577
           EPGYP+S L+D+MGC  P     D  + ++   III++D   S  V A A+V+P +L L 
Sbjct: 1485EPGYPKSALRDWMGC--PAGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLL 1658

Query: 578 LLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L +   VF F+R GTP+ +LYC+RS+ + V
Sbjct: 1659VLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV 1751
>dbj|AB047650.1|AB047650 Oryzias latipes MT5-MMP-del mRNA for membrane type-5 matrix
           metalloproteinase-variant, complete cds
          Length = 1721

 Score =  607 bits (1566), Expect = e-172
 Identities = 283/456 (62%), Positives = 340/456 (74%), Gaps = 1/456 (0%)
 Frame = +2

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           +  WL+ YGYL P + + S L   + M SA+AAMQ+FYGI +TG +D  T+ WM  PRCG
Sbjct: 182 IPTWLRNYGYLRPHNNQTSDLEQEKAMHSALAAMQRFYGIPVTGILDETTMQWMWTPRCG 361

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPDQ   S +   R KRYALTGQKW+ K I+YSI N TPKVG  +T++AIR+AF VWQ V
Sbjct: 362 VPDQPHTSRRQ--RNKRYALTGQKWREKKISYSISNYTPKVGQKDTQRAIRQAFSVWQMV 535

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPL+F+EVPY E++   ++ DI I FASGFHGDSSPFDGEGGFLAHAYFPG GIGGDTHF
Sbjct: 536 TPLSFQEVPYSEIKKEGKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGAGIGGDTHF 715

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDD 282
           DSDEPWTLGNP+ DGNDLFLVAVHELGHALGLEHSNDP+AIMAPFYQYM+T +F+LP DD
Sbjct: 716 DSDEPWTLGNPSSDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMDTRDFQLPLDD 895

Query: 283 LQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG-AK 341
           LQGIQKIYG                  R+   +                    + PG  K
Sbjct: 896 LQGIQKIYGVPTAMLEPTRPLPTLPSRRT--HSTSDRKHDRNSRPARPHSDRPALPGNGK 1069

Query: 342 PNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS 401
           PN+CDGNFNT+   RREMFVFKD+WFWR+RNN+V +GYPMQI  FW+GLPP IDA YE S
Sbjct: 1070PNVCDGNFNTVAFFRREMFVFKDRWFWRLRNNKVQEGYPMQIDQFWKGLPPRIDAAYERS 1249

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
           +G FVFFK +KFWVFK+ + +PGYP  L+ LG  +P  GID+A+ WE VGKTYFFKGD+Y
Sbjct: 1250DGKFVFFKGDKFWVFKEVSAEPGYPQSLLELGRSLPKEGIDTALRWEPVGKTYFFKGDQY 1429

Query: 462 WRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE 497
           WRY EE  ++DPGYPKPI++WKGIPE+PQGAF++++
Sbjct: 1430WRYNEERSTVDPGYPKPISVWKGIPEAPQGAFINRD 1537
 Score = 40.4 bits (93), Expect = 0.51
 Identities = 24/76 (31%), Positives = 36/76 (46%), Gaps = 1/76 (1%)
 Frame = +2

Query: 454  YFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNS 512
            + FK   +WR       +  GYP  I   WKG+P     A+   +  F +F  +K     
Sbjct: 1124 FVFKDRWFWRLRNN--KVQEGYPMQIDQFWKGLPPRIDAAYERSDGKFVFFKGDKFW--V 1291

Query: 513  TKMLRVEPGYPRSILK 528
             K +  EPGYP+S+L+
Sbjct: 1292 FKEVSAEPGYPQSLLE 1339
>dbj|D86331.1|D86331 Human MT2-MMP gene for matrix metalloprotein, complete cds
          Length = 1893

 Score =  572 bits (1475), Expect = e-161
 Identities = 282/576 (48%), Positives = 368/576 (62%), Gaps = 51/576 (8%)
 Frame = +3

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRR--KRYALTGQKWQHKHIAYSIKNVTP 141
           +TG +D  T +WMK+PRCGVPDQ     K N+RR  KRYALTG+KW + H+ +SI+N T 
Sbjct: 3   VTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQNYTE 182

Query: 142 KVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELE-NGKRDVDITIIFASGFHGDSSPFD 200
           K+G   + +A+RRAF VW+  TPL F+EVPY ++    +++ DI ++FASGFHGDSSPFD
Sbjct: 183 KLGWYHSMEAVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFD 362

Query: 201 GEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDP 260
           G GGFLAHAYFPGPG+GGDTHFD+DEPWT  + +  GN+LFLVAVHELGHALGLEHS++P
Sbjct: 363 GTGGFLAHAYFPGPGLGGDTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNP 542

Query: 261 TAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR---------- 310
            AIMAPFYQ+ + DNFKLP DDL+GIQ++YG                  R          
Sbjct: 543 NAIMAPFYQWKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPR 722

Query: 311 --SIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFW 368
               PP                           PNICDG+F+T+ +LR EMFVFK +WFW
Sbjct: 723 PPQPPPPGGKPERPPKPGPPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFW 902

Query: 369 RVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHD 428
           RVR+NRV+D YPM I +FWRGLP  I A YE  +G FVFFK +++W+F++  L+PGYP  
Sbjct: 903 RVRHNRVLDNYPMPIGHFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQP 1082

Query: 429 LITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPES 488
           L + G GIP   ID+AIWWE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP S
Sbjct: 1083LTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPAS 1262

Query: 489 PQGAFVHKENGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCD-----GPTDRDKD 542
           P+GAF+  +  +TYF K  K      + LR+EPGYP+SIL+DFMGC      GP   D  
Sbjct: 1263PKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVA 1442

Query: 543 R-------------HSPQDDVD-----------------IIIKLDNTASTVKAIAIVIPC 572
           R              S + DV                  ++++++  A TV  + +++P 
Sbjct: 1443RPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDRGSRVVVQMEEVARTVNVVMVLVPL 1622

Query: 573 ILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
           +L LC+L L Y + Q +R+G PR +LYCKRS+QEWV
Sbjct: 1623LLLLCVLGLTYALVQMQRKGAPRVLLYCKRSLQEWV 1730
>dbj|D85510.1|D85510 Homo sapiens mRNA for SMCP-2, partial cds
          Length = 2925

 Score =  502 bits (1293), Expect = e-140
 Identities = 247/507 (48%), Positives = 320/507 (62%), Gaps = 49/507 (9%)
 Frame = +2

Query: 151 AIRRAFDVWQNVTPLTFEEVPYIELE-NGKRDVDITIIFASGFHGDSSPFDGEGGFLAHA 209
           A+RRAF VW+  TPL F+EVPY ++    +++ DI ++FASGFHGDSSPFDG GGFLAHA
Sbjct: 2   AVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHA 181

Query: 210 YFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ 269
           YFPGPG+GGDTHFD+DEPWT  + +  GN+LFLVAVHELGHALGLEHS++P AIMAPFYQ
Sbjct: 182 YFPGPGLGGDTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQ 361

Query: 270 YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR------------SIPPAXX 317
           + + DNFKLP DDL+GIQ++YG                  R              PP   
Sbjct: 362 WKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGG 541

Query: 318 XXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMD 377
                                   PNICDG+F+T+ +LR EMFVFK +WFWRVR+NRV+D
Sbjct: 542 KPERPPKPGPPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLD 721

Query: 378 GYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIP 437
            YPM I +FWRGLP  I A YE  +G FVFFK +++W+F++  L+PGYP  L + G GIP
Sbjct: 722 NYPMPIGHFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIP 901

Query: 438 SHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE 497
              ID+AIWWE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP SP+GAF+  +
Sbjct: 902 YDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSND 1081

Query: 498 NGFTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCD-----GPTDRDKDR-------- 543
             +TYF K  K      + LR+EPGYP+SIL+DFMGC      GP   D  R        
Sbjct: 1082AAYTYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGG 1261

Query: 544 -----HSPQDDVD-----------------IIIKLDNTASTVKAIAIVIPCILALCLLVL 581
                 S + DV                  ++++++  A TV  + +++P +L LC+L L
Sbjct: 1262AEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGL 1441

Query: 582 VYTVFQFKREGTPRHILYCKRSMQEWV 608
            Y + Q +R+G PR +LYCKRS+QEWV
Sbjct: 1442TYALVQMQRKGAPRVLLYCKRSLQEWV 1522
>gb|AF267160.1|AF267160 Ovis aries membrane type-1 metalloproteinase mRNA, partial cds
          Length = 788

 Score =  335 bits (859), Expect = 8e-90
 Identities = 159/279 (56%), Positives = 193/279 (68%), Gaps = 1/279 (0%)
 Frame = +1

Query: 170 VPYIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPW 228
           VPY  +  G ++  DI I FA GFHGDS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPW
Sbjct: 1   VPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPW 180

Query: 229 TLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQK 288
           T+ N + +GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+M+T+NF LP+DD +GIQ+
Sbjct: 181 TVRNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQ 360

Query: 289 IYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN 348
           +YG                   SIP                        P   PNICDGN
Sbjct: 361 LYGSKSGSPTKIPPQPRTTSRPSIP-------------------DKPKNPTYGPNICDGN 483

Query: 349 FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFF 408
           F+T+ +LR EMFVFK++WFWRVR N+VMDGYPM I  FWRGLP SI+  YE  +G FVFF
Sbjct: 484 FDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFF 663

Query: 409 KSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWW 447
           K +K WVF + +L+PGYP  +  LG G+P+  ID+A++W
Sbjct: 664 KGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFW 780
 Score = 47.0 bits (110), Expect = 0.005
 Identities = 33/90 (36%), Positives = 47/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query: 451 GKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKST 509
           G+ + FK   +WR  +  + MD GYP PI   W+G+P S   A+  K+  F +F  +K  
Sbjct: 508 GEMFVFKERWFWRVRKN-QVMD-GYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHW 681

Query: 510 GNSTKMLRVEPGYPRSILKDFMGCDGPTDR 539
                 L  EPGYP+ I +  +G   PTDR
Sbjct: 682 VFDEASL--EPGYPKHIKE--LGRGLPTDR 759
>emb|AJ010731.1|MAJ10731 Mus musculus mRNA for membrane-type-4 matrix metalloproteinase
           (MT4-MMP)
          Length = 1987

 Score =  318 bits (814), Expect = 1e-84
 Identities = 192/548 (35%), Positives = 269/548 (49%), Gaps = 13/548 (2%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL ++GYLPP DP    L++ E +  AI AMQQF G+  TG +D  T+  MK PRC +PD
Sbjct: 243 WLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLPD 422

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVT--PKVGDAETRKAIRRAFDVWQNVT 163
              G+     RRKR      KW  +++++ ++       +G    R  +  A  VW ++T
Sbjct: 423 LPPGAQS---RRKRQTPPPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDIT 593

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
           PL F EV            DI I F+   H D  PFDG GG +AHA+FPG     GDTHF
Sbjct: 594 PLNFHEV-------AGNAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTHF 752

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD--NFKLPN 280
           D DEPWT  + +  G DLF VAVHE GHA+GL H   P++IM P+YQ    D   + LP 
Sbjct: 753 DDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPLRYGLPY 932

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           +D   + ++YG                    + P                     S P  
Sbjct: 933 EDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLP--------------EPPNNRSSTPPQ 1070

Query: 341 K--PNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLP---PSI 394
           K  P+ C  +F+ +  +R E F FK ++FWR+ R+  ++   P Q+  FWRGLP    S+
Sbjct: 1071KDVPHRCTAHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSV 1250

Query: 395 DAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DAVYE  S+   VFFK +++WVFKD  ++ GYP  +      +P  GID+   W    +T
Sbjct: 1251DAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDF--SLPPGGIDAVFSWAHNDRT 1424

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
           YFFK   YWRY +  R MDPGYP    +W+G+P     A    +    +F  ++      
Sbjct: 1425YFFKDQLYWRYDDHTRRMDPGYPAQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLD 1604

Query: 514 KMLRVEPGYPRSILKDFMGCDGP-TDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPC 572
             L   PGYP+S  +D++ C  P  D +     PQ        L   + T  A  + +P 
Sbjct: 1605GELEAAPGYPQSTARDWLVCGEPLADAEDVGPGPQGRSGAQDGLAVCSCTSDAHRLALPS 1784

Query: 573 ILALCLLV 580
           +L L  L+
Sbjct: 1785LLLLTPLL 1808
>ref|NM_011846.1| Mus musculus matrix metalloproteinase 17 (Mmp17), mRNA
          Length = 3490

 Score =  318 bits (814), Expect = 1e-84
 Identities = 192/548 (35%), Positives = 269/548 (49%), Gaps = 13/548 (2%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL ++GYLPP DP    L++ E +  AI AMQQF G+  TG +D  T+  MK PRC +PD
Sbjct: 245 WLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLPD 424

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVT--PKVGDAETRKAIRRAFDVWQNVT 163
              G+     RRKR      KW  +++++ ++       +G    R  +  A  VW ++T
Sbjct: 425 LPPGAQS---RRKRQTPPPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDIT 595

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
           PL F EV            DI I F+   H D  PFDG GG +AHA+FPG     GDTHF
Sbjct: 596 PLNFHEV-------AGNAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTHF 754

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD--NFKLPN 280
           D DEPWT  + +  G DLF VAVHE GHA+GL H   P++IM P+YQ    D   + LP 
Sbjct: 755 DDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPVRYGLPY 934

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           +D   + ++YG                    + P                     S P  
Sbjct: 935 EDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLP--------------EPPNNRSSTPPQ 1072

Query: 341 K--PNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLP---PSI 394
           K  P+ C  +F+ +  +R E F FK ++FWR+ R+  ++   P Q+  FWRGLP    S+
Sbjct: 1073KDVPHRCTAHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSV 1252

Query: 395 DAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DAVYE  S+   VFFK +++WVFKD  ++ GYP  +      +P  GID+   W    +T
Sbjct: 1253DAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDF--SLPPGGIDAVFSWAHNDRT 1426

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
           YFFK   YWRY +  R MDPGYP    +W+G+P     A    +    +F  ++      
Sbjct: 1427YFFKDQLYWRYDDHTRRMDPGYPAQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLD 1606

Query: 514 KMLRVEPGYPRSILKDFMGCDGP-TDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPC 572
             L   PGYP+S  +D++ C  P  D +     PQ        L   + T  A  + +P 
Sbjct: 1607GELEAAPGYPQSTARDWLVCGEPLADAEDVGPGPQGRSGAQDGLAVCSCTSDAHRLALPS 1786

Query: 573 ILALCLLV 580
           +L L  L+
Sbjct: 1787LLLLTPLL 1810
>dbj|AB021224.1|AB021224 Mus musculus mRNA for membrane-type-4 matrix metalloproteinase,
           complete cds
          Length = 3490

 Score =  318 bits (814), Expect = 1e-84
 Identities = 192/548 (35%), Positives = 269/548 (49%), Gaps = 13/548 (2%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL ++GYLPP DP    L++ E +  AI AMQQF G+  TG +D  T+  MK PRC +PD
Sbjct: 245 WLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLPD 424

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVT--PKVGDAETRKAIRRAFDVWQNVT 163
              G+     RRKR      KW  +++++ ++       +G    R  +  A  VW ++T
Sbjct: 425 LPPGAQS---RRKRQTPPPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDIT 595

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
           PL F EV            DI I F+   H D  PFDG GG +AHA+FPG     GDTHF
Sbjct: 596 PLNFHEV-------AGNAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTHF 754

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD--NFKLPN 280
           D DEPWT  + +  G DLF VAVHE GHA+GL H   P++IM P+YQ    D   + LP 
Sbjct: 755 DDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPVRYGLPY 934

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           +D   + ++YG                    + P                     S P  
Sbjct: 935 EDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLP--------------EPPNNRSSTPPQ 1072

Query: 341 K--PNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLP---PSI 394
           K  P+ C  +F+ +  +R E F FK ++FWR+ R+  ++   P Q+  FWRGLP    S+
Sbjct: 1073KDVPHRCTAHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSV 1252

Query: 395 DAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DAVYE  S+   VFFK +++WVFKD  ++ GYP  +      +P  GID+   W    +T
Sbjct: 1253DAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDF--SLPPGGIDAVFSWAHNDRT 1426

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
           YFFK   YWRY +  R MDPGYP    +W+G+P     A    +    +F  ++      
Sbjct: 1427YFFKDQLYWRYDDHTRRMDPGYPAQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLD 1606

Query: 514 KMLRVEPGYPRSILKDFMGCDGP-TDRDKDRHSPQDDVDIIIKLDNTASTVKAIAIVIPC 572
             L   PGYP+S  +D++ C  P  D +     PQ        L   + T  A  + +P 
Sbjct: 1607GELEAAPGYPQSTARDWLVCGEPLADAEDVGPGPQGRSGAQDGLAVCSCTSDAHRLALPS 1786

Query: 573 ILALCLLV 580
           +L L  L+
Sbjct: 1787LLLLTPLL 1810
>gb|AF185270.1|AF185270 Homo sapiens leukolysin (MMP25) mRNA, complete cds
          Length = 2667

 Score =  317 bits (812), Expect = 2e-84
 Identities = 185/513 (36%), Positives = 268/513 (52%), Gaps = 11/513 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP  P  + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 127 WLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 306

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 307 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 483

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 484 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 651

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 652 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 831

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 832 DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 960

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 961 IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1140

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1141AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1314

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1315VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1491

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1492SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1590
>gb|AF145442.2|AF145442 Homo sapiens leukolysin mRNA, complete cds
          Length = 2667

 Score =  317 bits (812), Expect = 2e-84
 Identities = 185/513 (36%), Positives = 268/513 (52%), Gaps = 11/513 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP  P  + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 127 WLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 306

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 307 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 483

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 484 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 651

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 652 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 831

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 832 DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 960

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 961 IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1140

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1141AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1314

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1315VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1491

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1492SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1590
>ref|NM_022468.2| Homo sapiens matrix metalloproteinase 25 (MMP25), transcript
           variant 1, mRNA
          Length = 3557

 Score =  317 bits (812), Expect = 2e-84
 Identities = 185/513 (36%), Positives = 268/513 (52%), Gaps = 11/513 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP  P  + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 340 WLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 519

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 520 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 696

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 697 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 864

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 865 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 1044

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 1045DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 1173

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 1174IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1353

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1354AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1527

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1528VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1704

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1705SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1803
>emb|AJ272137.1|HSA272137 Homo sapiens mRNA for membrane type matrix metalloproteinase number
           6, (MT6-MMP gene)
          Length = 3586

 Score =  317 bits (812), Expect = 2e-84
 Identities = 185/513 (36%), Positives = 268/513 (52%), Gaps = 11/513 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP  P  + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 340 WLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 519

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 520 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 696

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 697 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 864

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 865 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 1044

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 1045DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 1173

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 1174IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1353

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1354AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1527

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1528VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1704

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1705SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1803
>emb|AJ239053.1|HSA239053 Homo sapiens mRNA for matrix metalloproteinase-25 (MMP-25)
          Length = 2917

 Score =  317 bits (812), Expect = 2e-84
 Identities = 185/513 (36%), Positives = 268/513 (52%), Gaps = 11/513 (2%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP  P  + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 284 WLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 463

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 464 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 640

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 641 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 808

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 809 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 988

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 989 DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 1117

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 1118IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1297

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1298AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1471

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1472VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1648

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1649SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1747
>ref|NM_022718.1| Homo sapiens matrix metalloproteinase 25 (MMP25), transcript
           variant 2, mRNA
          Length = 2973

 Score =  317 bits (812), Expect = 2e-84
 Identities = 185/513 (36%), Positives = 268/513 (52%), Gaps = 11/513 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP  P  + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 340 WLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 519

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 520 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 696

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 697 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 864

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 865 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 1044

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 1045DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 1173

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 1174IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1353

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1354AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1527

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1528VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1704

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1705SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1803
>dbj|AB042328.1|AB042328 Homo sapiens mt6-mmp mRNA for membrane-type 6 matrix
           metalloproteinase, complete cds
          Length = 3311

 Score =  313 bits (803), Expect = 2e-83
 Identities = 184/513 (35%), Positives = 267/513 (51%), Gaps = 11/513 (2%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL +YGYLPP     + L+S E ++ AI  MQ+F G+  TG++D  T+  M+KPRC +PD
Sbjct: 272 WLTRYGYLPPPHRAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPD 451

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
              G +    RR+RYAL+G  W+ + + + +++   + ++     R  +  A   W   +
Sbjct: 452 -VLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMES 628

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG-IGGDTHF 222
            LTF EV   +     ++ DI I FA  FH DS PFDG GG LAHA+FPG   I GDTHF
Sbjct: 629 GLTFHEVDSPQ----GQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHF 796

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKLPN 280
           D +E WT G+ + +G DLF VAVHE GHALGL HS+ P +IM PFYQ    + D ++L  
Sbjct: 797 DDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQ 976

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD  G+Q++YG                     PPA                    S+P  
Sbjct: 977 DDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ-PPA--------------SPTHSPSFP-- 1105

Query: 341 KPNICDGNFNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSIDAVY- 398
            P+ C+GNF+ +  +R E F FK  WFWR++ + +++   P ++  FW GLP  +  V  
Sbjct: 1106IPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQA 1285

Query: 399 ---ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
               + +G  + F   +FWVF+D  L+ G    L  LG   P   +D+   W   GKTY 
Sbjct: 1286AYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLTELGLP-PGEEVDAVFSWPQNGKTYL 1459

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK- 514
            +G +YWRY E     DPGYP+ +++W+G P SP    V    G TYF K        K 
Sbjct: 1460VRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTV-SNAGDTYFFKGAHYWRFPKN 1636

Query: 515 MLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQ 547
            ++ EP  P+ +  +++ C  P+   +    P+
Sbjct: 1637SIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPK 1735
>emb|X89576.1|HSMMP17 Homo sapiens mRNA for putative MT2-MMP protein
          Length = 2306

 Score =  304 bits (779), Expect = 1e-80
 Identities = 180/500 (36%), Positives = 250/500 (50%), Gaps = 12/500 (2%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL ++GYLPP DP    L++ E +  AI AMQQF G+  TG +D  T+  MK PRC +PD
Sbjct: 143 WLSRFGYLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPD 322

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
                     RR+R A    KW  +++++ ++       +G    R  +  A  VW ++ 
Sbjct: 323 L---PVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIA 493

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPG-PGIGGDTHF 222
           PL F EV            DI I F+   H D  PFDG GG +AHA+FPG     GDTHF
Sbjct: 494 PLNFHEV-------AGSTADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHF 652

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD--NFKLPN 280
           D DE WT  + +  G DLF VAVHE GHA+GL H     +IM P+YQ    D   + LP 
Sbjct: 653 DDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPY 832

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           +D   + ++YG                     PP                     S P  
Sbjct: 833 EDKVRVWQLYGVRESVSPTAQPEEPPLLPE--PP-----------------DNRSSAPPR 955

Query: 341 K--PNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLP---PSI 394
           K  P+ C  +F+ +  +R E F FK ++FWR+ R+  ++   P Q+  FWRGLP    S+
Sbjct: 956 KDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSV 1135

Query: 395 DAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DAVYE  S+   VFFK +++WVFKD  ++ GYP  +      +P  GID+A  W    +T
Sbjct: 1136DAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDF--SLPPGGIDAAFSWAHNDRT 1309

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
           YFFK   YWRY +  R MDPGYP    +W+G+P +   A    +    +F  ++      
Sbjct: 1310YFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLD 1489

Query: 514 KMLRVEPGYPRSILKDFMGC 533
             L V PGYP+S  +D++ C
Sbjct: 1490GELEVAPGYPQSTARDWLVC 1549
>ref|NM_016155.2| Homo sapiens matrix metalloproteinase 17 (membrane-inserted)
           (MMP17), mRNA
          Length = 2438

 Score =  304 bits (779), Expect = 1e-80
 Identities = 180/500 (36%), Positives = 250/500 (50%), Gaps = 12/500 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL ++GYLPP DP    L++ E +  AI AMQQF G+  TG +D  T+  MK PRC +PD
Sbjct: 271 WLSRFGYLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPD 450

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
                     RR+R A    KW  +++++ ++       +G    R  +  A  VW ++ 
Sbjct: 451 L---PVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIA 621

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPG-PGIGGDTHF 222
           PL F EV            DI I F+   H D  PFDG GG +AHA+FPG     GDTHF
Sbjct: 622 PLNFHEV-------AGSTADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHF 780

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD--NFKLPN 280
           D DE WT  + +  G DLF VAVHE GHA+GL H     +IM P+YQ    D   + LP 
Sbjct: 781 DDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPY 960

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           +D   + ++YG                     PP                     S P  
Sbjct: 961 EDKVRVWQLYGVRESVSPTAQPEEPPLLPE--PP-----------------DNRSSAPPR 1083

Query: 341 K--PNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLP---PSI 394
           K  P+ C  +F+ +  +R E F FK ++FWR+ R+  ++   P Q+  FWRGLP    S+
Sbjct: 1084KDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSV 1263

Query: 395 DAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DAVYE  S+   VFFK +++WVFKD  ++ GYP  +      +P  GID+A  W    +T
Sbjct: 1264DAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDF--SLPPGGIDAAFSWAHNDRT 1437

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
           YFFK   YWRY +  R MDPGYP    +W+G+P +   A    +    +F  ++      
Sbjct: 1438YFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLD 1617

Query: 514 KMLRVEPGYPRSILKDFMGC 533
             L V PGYP+S  +D++ C
Sbjct: 1618GELEVAPGYPQSTARDWLVC 1677
>dbj|AB021225.2| Homo sapiens mt4-mmp mRNA for membrane-type-4 matrix
           metalloproteinase, complete cds
          Length = 2438

 Score =  304 bits (779), Expect = 1e-80
 Identities = 180/500 (36%), Positives = 250/500 (50%), Gaps = 12/500 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           WL ++GYLPP DP    L++ E +  AI AMQQF G+  TG +D  T+  MK PRC +PD
Sbjct: 271 WLSRFGYLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPD 450

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
                     RR+R A    KW  +++++ ++       +G    R  +  A  VW ++ 
Sbjct: 451 L---PVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIA 621

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPG-PGIGGDTHF 222
           PL F EV            DI I F+   H D  PFDG GG +AHA+FPG     GDTHF
Sbjct: 622 PLNFHEV-------AGSTADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHF 780

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD--NFKLPN 280
           D DE WT  + +  G DLF VAVHE GHA+GL H     +IM P+YQ    D   + LP 
Sbjct: 781 DDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPY 960

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           +D   + ++YG                     PP                     S P  
Sbjct: 961 EDKVRVWQLYGVRESVSPTAQPEEPPLLPE--PP-----------------DNRSSAPPR 1083

Query: 341 K--PNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLP---PSI 394
           K  P+ C  +F+ +  +R E F FK ++FWR+ R+  ++   P Q+  FWRGLP    S+
Sbjct: 1084KDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSV 1263

Query: 395 DAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DAVYE  S+   VFFK +++WVFKD  ++ GYP  +      +P  GID+A  W    +T
Sbjct: 1264DAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDF--SLPPGGIDAAFSWAHNDRT 1437

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
           YFFK   YWRY +  R MDPGYP    +W+G+P +   A    +    +F  ++      
Sbjct: 1438YFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLD 1617

Query: 514 KMLRVEPGYPRSILKDFMGC 533
             L V PGYP+S  +D++ C
Sbjct: 1618GELEVAPGYPQSTARDWLVC 1677
>ref|NM_002424.1| Homo sapiens matrix metalloproteinase 8 (neutrophil collagenase)
           (MMP8), mRNA
          Length = 2223

 Score =  292 bits (748), Expect = 6e-77
 Identities = 170/467 (36%), Positives = 245/467 (52%), Gaps = 6/467 (1%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+K+  LP    + +       +   +  MQ+F+G+N+TGK +  T+D MKKPRCG
Sbjct: 168 VQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCG 347

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD              + LT    KW+  ++ Y I+N TP++ +AE  +AI+ AF++W 
Sbjct: 348 VPDSGG-----------FMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWS 494

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
             +PL F  +        + + DI I F    HGD+SPFDG  G LAHA+ PG GIGGD 
Sbjct: 495 VASPLIFTRI-------SQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDA 653

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD++E WT  + N++   LFLVA HE GH+LGL HS+DP A+M P Y + ET N+ LP 
Sbjct: 654 HFDAEETWTNTSANYN---LFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQ 824

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                    I P                         +
Sbjct: 825 DDIDGIQAIYGLSS---------------NPIQPTG----------------------PS 893

Query: 341 KPNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
            P  CD +  F+ +  LR E+  FKD++FWR R+ ++       I+ FW  LP  I A Y
Sbjct: 894 TPKPCDPSLTFDAITTLRGEILFFKDRYFWR-RHPQLQRVEMNFISLFWPSLPTGIQAAY 1070

Query: 399 ENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
           E+ + + +F FK N++W      +  GYP D+   G       ID+A+++    KTYFF 
Sbjct: 1071EDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYR--SKTYFFV 1244

Query: 458 GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
            D++WRY  + + M+PGYPK I+  + GI ES   A   +E+ F  F
Sbjct: 1245NDQFWRYDNQRQFMEPGYPKSISGAFPGI-ESKVDAVFQQEHFFHVF 1382
>gb|J05556.1|HUMCLGNA Homo sapiens collagenase mRNA, complete cds
          Length = 2223

 Score =  292 bits (748), Expect = 6e-77
 Identities = 170/467 (36%), Positives = 245/467 (52%), Gaps = 6/467 (1%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+K+  LP    + +       +   +  MQ+F+G+N+TGK +  T+D MKKPRCG
Sbjct: 168 VQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCG 347

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD              + LT    KW+  ++ Y I+N TP++ +AE  +AI+ AF++W 
Sbjct: 348 VPDSGG-----------FMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWS 494

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
             +PL F  +        + + DI I F    HGD+SPFDG  G LAHA+ PG GIGGD 
Sbjct: 495 VASPLIFTRI-------SQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDA 653

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD++E WT  + N++   LFLVA HE GH+LGL HS+DP A+M P Y + ET N+ LP 
Sbjct: 654 HFDAEETWTNTSANYN---LFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQ 824

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                    I P                         +
Sbjct: 825 DDIDGIQAIYGLSS---------------NPIQPTG----------------------PS 893

Query: 341 KPNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
            P  CD +  F+ +  LR E+  FKD++FWR R+ ++       I+ FW  LP  I A Y
Sbjct: 894 TPKPCDPSLTFDAITTLRGEILFFKDRYFWR-RHPQLQRVEMNFISLFWPSLPTGIQAAY 1070

Query: 399 ENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
           E+ + + +F FK N++W      +  GYP D+   G       ID+A+++    KTYFF 
Sbjct: 1071EDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYR--SKTYFFV 1244

Query: 458 GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
            D++WRY  + + M+PGYPK I+  + GI ES   A   +E+ F  F
Sbjct: 1245NDQFWRYDNQRQFMEPGYPKSISGAFPGI-ESKVDAVFQQEHFFHVF 1382
>gb|U88652.1|OCU88652 Oryctolagus cuniculus macrophage metalloelastase MMP-12 precursor,
           mRNA, complete cds
          Length = 1792

 Score =  288 bits (738), Expect = 8e-76
 Identities = 176/470 (37%), Positives = 244/470 (51%), Gaps = 8/470 (1%)
 Frame = +1

Query: 19  RVLFLQTCVWILC--ATVCKAEQYFNVEVWLQK-YGYLPPTDPRMSVLRSAETMQSAIAA 75
           + L L   +W+    A   K       E +L+  YG      P   +  +   ++  +  
Sbjct: 34  KFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQE 213

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQK-WQHKHIAY 134
           MQQF G+N+TG++D +T++ M KPRCGVPD     +          + G+  W+  +I Y
Sbjct: 214 MQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKT----------MPGRPVWRKHYITY 363

Query: 135 SIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHG 194
            IKN TP +   +   AI++AF VW +VTPL F ++       GK   DI I+FASG HG
Sbjct: 364 RIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKIT-----TGK--ADIMILFASGAHG 522

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           D   FDG GG +AHA+ PGPGIGGDTHFD DE W+    ++ G +LFLVAVHELGHALGL
Sbjct: 523 DYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWS---KSYKGTNLFLVAVHELGHALGL 693

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           +HSNDP AIM P Y Y++ + F L  DD++GIQ +YG                 H+ +P 
Sbjct: 694 DHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYG-------------GPEQHQPMPK 834

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWF-WRVR 371
                                     +P  CD N  F+ +  +  ++F FKD +F W++ 
Sbjct: 835 P----------------------DNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIP 948

Query: 372 NNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLI 430
            +         I+  W  LP  I+A YE  + + VF FK +KFW+     LQP YP  + 
Sbjct: 949 KSSTTS--VRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIH 1122

Query: 431 TLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           +LG       ID+A++   + KTYFF  + YWRY E    MD GYPK IT
Sbjct: 1123SLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLIT 1272
 Score = 36.6 bits (83), Expect = 7.4
 Identities = 20/44 (45%), Positives = 26/44 (58%), Gaps = 2/44 (4%)
 Frame = +1

Query: 357  REMFVFKDQWFWRVRNNR-VMD-GYPMQITYFWRGLPPSIDAVY 398
            R+ + F D  +WR    R VMD GYP  IT  + G+ P IDAV+
Sbjct: 1183 RKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVF 1314
>dbj|AB006779.1|AB006779 Oryctolagus cuniculus mRNA for matrix metalloproteinase-12,
           complete cds
          Length = 1746

 Score =  288 bits (737), Expect = 1e-75
 Identities = 175/470 (37%), Positives = 243/470 (51%), Gaps = 8/470 (1%)
 Frame = +1

Query: 19  RVLFLQTCVWILC--ATVCKAEQYFNVEVWLQK-YGYLPPTDPRMSVLRSAETMQSAIAA 75
           + L L   +W+    A   K       E +L+  YG      P   +  +   ++  +  
Sbjct: 19  KFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQE 198

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQK-WQHKHIAY 134
           MQQF G+N+TG++D +T++ M KPRCGVPD     +          + G+  W+  +I Y
Sbjct: 199 MQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKT----------MPGRPVWRKHYITY 348

Query: 135 SIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHG 194
            IKN TP +   +   AI++AF VW +VTPL F ++   E        DI I+FASG HG
Sbjct: 349 RIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGE-------ADIMILFASGAHG 507

Query: 195 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGL 254
           D   FDG GG +AHA+ PGPGIGGDTHFD DE W+    ++ G +LFLVAVHELGHALGL
Sbjct: 508 DYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWS---KSYKGTNLFLVAVHELGHALGL 678

Query: 255 EHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPP 314
           +HSNDP AIM P Y Y++ + F L  DD++GIQ +YG                 H+ +P 
Sbjct: 679 DHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYG-------------GPEQHQPMPK 819

Query: 315 AXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWF-WRVR 371
                                     +P  CD N  F+ +  +  ++F FKD +F W++ 
Sbjct: 820 P----------------------DNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIP 933

Query: 372 NNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLI 430
            +         I+  W  LP  I+A YE  + + VF FK +KFW+     LQP YP  + 
Sbjct: 934 KSSTTS--VRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIH 1107

Query: 431 TLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           +LG       ID+A++   + KTYFF  + YWRY E    MD GYPK IT
Sbjct: 1108SLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLIT 1257
 Score = 36.6 bits (83), Expect = 7.4
 Identities = 20/44 (45%), Positives = 26/44 (58%), Gaps = 2/44 (4%)
 Frame = +1

Query: 357  REMFVFKDQWFWRVRNNR-VMD-GYPMQITYFWRGLPPSIDAVY 398
            R+ + F D  +WR    R VMD GYP  IT  + G+ P IDAV+
Sbjct: 1168 RKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVF 1299
>gb|AF144758.1|AF144758 Bos taurus MT1-MMP protein (MMP-14) mRNA, partial cds
          Length = 784

 Score =  287 bits (734), Expect = 2e-75
 Identities = 145/280 (51%), Positives = 179/280 (63%), Gaps = 4/280 (1%)
 Frame = +2

Query: 112 KFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVP 171
           K N+RRKRYA+ G KWQH  I + I+N TPKVG+  T +AIR+AF VW++ TPL F EVP
Sbjct: 38  KANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVP 217

Query: 172 YIELENG-KRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTL 230
           Y  +  G ++  DI I FA GFHGD + FDGEGGFLA AYFPGP + G            
Sbjct: 218 YAYIREGHEKQADILIFFAEGFHGDITAFDGEGGFLALAYFPGPNLEG------------ 361

Query: 231 GNPNHD---GNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQ 287
           G+P ++   GND+FLVAVHELGHALGLEHSNDP+AIMAPFYQ+M+T+NF LP+DD +GIQ
Sbjct: 362 GHPKNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQ 541

Query: 288 KIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDG 347
           ++YG                   S+P                        P   PNICDG
Sbjct: 542 QLYGSKSGSPTKMPPQPRTTSRPSVP-------------------DKPKNPTYGPNICDG 664

Query: 348 NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFW 387
           NF+T+ +LR EM VFK++WFWRVR N+VMDGYPM I  +W
Sbjct: 665 NFDTVAMLRGEMLVFKERWFWRVRKNQVMDGYPMPIGQYW 784
>ref|NM_008611.1| Mus musculus matrix metalloproteinase 8 (Mmp8), mRNA
          Length = 1961

 Score =  284 bits (727), Expect = 2e-74
 Identities = 172/441 (39%), Positives = 229/441 (51%), Gaps = 5/441 (1%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+K+  LP    R S  R+A  +   +  MQ+F+ +  TGK+D  T+  M+ PRCGV
Sbjct: 179 ENYLRKFYNLPSNQFRSS--RNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGV 352

Query: 104 PDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           PD              + LT    KW H ++ Y I N TP++  AE + AI +AF VW  
Sbjct: 353 PDSGD-----------FLLTPGSPKWTHTNLTYWIINHTPQLSRAEVKTAIEKAFHVWSV 499

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            +PLTF E+        + + DI I F S  HGD+SPFDG  G LAHA+ PG GIGGD H
Sbjct: 500 ASPLTFTEIL-------QGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAH 658

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FDS+E WT  + N+   +LFLVA HE GH+LGL HS DP A+M P Y Y E   + LP D
Sbjct: 659 FDSEETWTQDSKNY---NLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQD 829

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                    I P                         + 
Sbjct: 830 DINGIQTIYG---------------PSDNPIQPTG----------------------PST 898

Query: 342 PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P  CD +  F+    LR E++ FK+++FWR R+ ++       I+ FW GLP  + A YE
Sbjct: 899 PKACDPHLRFDATTTLRGEIYFFKEKYFWR-RHPQLRTVDLNFISLFWPGLPNGLQAAYE 1075

Query: 400 NSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           + + + VF FK  ++W      LQ GYP D+   G       ID+A+ +   GKTYFF  
Sbjct: 1076DFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYN--GKTYFFIN 1249

Query: 459 DRYWRYGEEMRSMDPGYPKPI 479
           ++ WRY  E RSMDPGYPK I
Sbjct: 1250NQCWRYDNERRSMDPGYPKSI 1312
>gb|U96696.1|MMU96696 Mus musculus neutrophil collagenase MNC mRNA, complete cds
          Length = 1961

 Score =  284 bits (727), Expect = 2e-74
 Identities = 172/441 (39%), Positives = 229/441 (51%), Gaps = 5/441 (1%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+K+  LP    R S  R+A  +   +  MQ+F+ +  TGK+D  T+  M+ PRCGV
Sbjct: 179 ENYLRKFYNLPSNQFRSS--RNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGV 352

Query: 104 PDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           PD              + LT    KW H ++ Y I N TP++  AE + AI +AF VW  
Sbjct: 353 PDSGD-----------FLLTPGSPKWTHTNLTYWIINHTPQLSRAEVKTAIEKAFHVWSV 499

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            +PLTF E+        + + DI I F S  HGD+SPFDG  G LAHA+ PG GIGGD H
Sbjct: 500 ASPLTFTEIL-------QGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAH 658

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FDS+E WT  + N+   +LFLVA HE GH+LGL HS DP A+M P Y Y E   + LP D
Sbjct: 659 FDSEETWTQDSKNY---NLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQD 829

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                    I P                         + 
Sbjct: 830 DINGIQTIYG---------------PSDNPIQPTG----------------------PST 898

Query: 342 PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P  CD +  F+    LR E++ FK+++FWR R+ ++       I+ FW GLP  + A YE
Sbjct: 899 PKACDPHLRFDATTTLRGEIYFFKEKYFWR-RHPQLRTVDLNFISLFWPGLPNGLQAAYE 1075

Query: 400 NSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           + + + VF FK  ++W      LQ GYP D+   G       ID+A+ +   GKTYFF  
Sbjct: 1076DFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYN--GKTYFFIN 1249

Query: 459 DRYWRYGEEMRSMDPGYPKPI 479
           ++ WRY  E RSMDPGYPK I
Sbjct: 1250NQCWRYDNERRSMDPGYPKSI 1312
>ref|NM_079128.1| Drosophila melanogaster Matrix metalloproteinase 1 (Mmp1), mRNA
          Length = 2315

 Score =  282 bits (721), Expect = 8e-74
 Identities = 175/497 (35%), Positives = 243/497 (48%), Gaps = 7/497 (1%)
 Frame = +2

Query: 44  EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           E++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 503 EIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 682

Query: 102 GVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           GV D+         R KRYAL G +W+ K++ Y I     ++   +    I RAF VW  
Sbjct: 683 GVRDRVGTGDS---RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWSE 853

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            T LTF              V I I F    HGD   FDG+GG LAHA+FP    GGD H
Sbjct: 854 DTDLTFTR-------KTSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAH 1006

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FD  E WT+G+P   G +LF VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  D
Sbjct: 1007FDDAELWTIGSPR--GTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFE-PVFKLDED 1177

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D   IQ +YG                     PP                          K
Sbjct: 1178DKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSI-----------------CK 1306

Query: 342 PNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS 401
            +  D  FN+    + E + FK   ++++  + V +GYP  I+  W GLP +IDA +   
Sbjct: 1307DSKVDTLFNS---AQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYK 1477

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
            G   FFK  ++W ++   +   YP ++    +GIP H +D+A+ W   GK YFFKG ++
Sbjct: 1478NGKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKF 1654

Query: 462 WRYGEEMR-SMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRVE 519
           WR+    R  +   YPKPI+ W+G+P +   A  +  NG+TYF K +K          V+
Sbjct: 1655WRFDPAKRPPVKASYPKPISNWEGVPNNLDAALKY-TNGYTYFFKGDKYYRFHDARFAVD 1831

Query: 520 ---PGYPRSILKDFMGC 533
              P +PR     + GC
Sbjct: 1832SATPPFPRPTAHWWFGC 1882
>gb|AF271666.1|AF271666 Drosophila melanogaster matrix metalloproteinase 1 mRNA, complete
           cds
          Length = 2315

 Score =  282 bits (721), Expect = 8e-74
 Identities = 175/497 (35%), Positives = 243/497 (48%), Gaps = 7/497 (1%)
 Frame = +2

Query: 44  EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           E++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 503 EIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 682

Query: 102 GVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           GV D+         R KRYAL G +W+ K++ Y I     ++   +    I RAF VW  
Sbjct: 683 GVRDRVGTGDS---RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWSE 853

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            T LTF              V I I F    HGD   FDG+GG LAHA+FP    GGD H
Sbjct: 854 DTDLTFTR-------KTSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAH 1006

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FD  E WT+G+P   G +LF VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  D
Sbjct: 1007FDDAELWTIGSPR--GTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFE-PVFKLDED 1177

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D   IQ +YG                     PP                          K
Sbjct: 1178DKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSI-----------------CK 1306

Query: 342 PNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS 401
            +  D  FN+    + E + FK   ++++  + V +GYP  I+  W GLP +IDA +   
Sbjct: 1307DSKVDTLFNS---AQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYK 1477

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
            G   FFK  ++W ++   +   YP ++    +GIP H +D+A+ W   GK YFFKG ++
Sbjct: 1478NGKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKF 1654

Query: 462 WRYGEEMR-SMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRVE 519
           WR+    R  +   YPKPI+ W+G+P +   A  +  NG+TYF K +K          V+
Sbjct: 1655WRFDPAKRPPVKASYPKPISNWEGVPNNLDAALKY-TNGYTYFFKGDKYYRFHDARFAVD 1831

Query: 520 ---PGYPRSILKDFMGC 533
              P +PR     + GC
Sbjct: 1832SATPPFPRPTAHWWFGC 1882
>ref|XM_080576.1| Matrix metalloproteinase 1, mRNA
          Length = 2300

 Score =  282 bits (721), Expect = 8e-74
 Identities = 175/497 (35%), Positives = 243/497 (48%), Gaps = 7/497 (1%)
 Frame = +2

Query: 44  EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           E++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 512 EIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 691

Query: 102 GVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           GV D+         R KRYAL G +W+ K++ Y I     ++   +    I RAF VW  
Sbjct: 692 GVRDRVGTGDS---RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWSE 862

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            T LTF              V I I F    HGD   FDG+GG LAHA+FP    GGD H
Sbjct: 863 DTDLTFTR-------KTSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAH 1015

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FD  E WT+G+P   G +LF VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  D
Sbjct: 1016FDDAELWTIGSPR--GTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFE-PVFKLDED 1186

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D   IQ +YG                     PP                          K
Sbjct: 1187DKAAIQSLYGRKTNQLRPTNVYPATTQRPYSPPKVPLDDSI-----------------CK 1315

Query: 342 PNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS 401
            +  D  FN+    + E + FK   ++++  + V +GYP  I+  W GLP +IDA +   
Sbjct: 1316DSKVDTLFNS---AQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYK 1486

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
            G   FFK  ++W ++   +   YP ++    +GIP H +D+A+ W   GK YFFKG ++
Sbjct: 1487NGKTYFFKGTQYWRYQGRQMDGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKF 1663

Query: 462 WRYGEEMR-SMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKMLRVE 519
           WR+    R  +   YPKPI+ W+G+P +   A  +  NG+TYF K +K          V+
Sbjct: 1664WRFDPAKRPPVKASYPKPISNWEGVPNNLDAALKY-TNGYTYFFKGDKYYRFHDARFAVD 1840

Query: 520 ---PGYPRSILKDFMGC 533
              P +PR     + GC
Sbjct: 1841SATPPFPRPTAHWWFGC 1891
>emb|Y13342.1|MMY13342 Mus musculus mRNA for collagenase-2
          Length = 1480

 Score =  282 bits (721), Expect = 8e-74
 Identities = 171/441 (38%), Positives = 228/441 (50%), Gaps = 5/441 (1%)
 Frame = +3

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+K+  LP    R S  R+A  +   +  MQ+F+ +  TGK+D  T+  M+ PRCGV
Sbjct: 111 ENYLRKFYNLPSNQFRSS--RNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGV 284

Query: 104 PDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           PD              + LT    KW H ++ Y I N TP++  AE + AI +AF VW  
Sbjct: 285 PDSGD-----------FLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSV 431

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            +PLTF E+        + + DI I F S  HGD+SPFDG  G LAHA+ PG GIGGD H
Sbjct: 432 ASPLTFTEIL-------QGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAH 590

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FDS+E WT  + N+   +LFLVA HE GH+LGL HS DP A+M P Y Y E   + LP D
Sbjct: 591 FDSEETWTQDSKNY---NLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQD 761

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                    I P                         + 
Sbjct: 762 DINGIQTIYG---------------PSDNPIQPTG----------------------PST 830

Query: 342 PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P  CD +  F+    LR E++ FKD++FWR R+ ++       I+ FW  LP  + A YE
Sbjct: 831 PKACDPHLRFDATTTLRGEIYFFKDKYFWR-RHPQLRTVDLNFISLFWPFLPNGLQAAYE 1007

Query: 400 NSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           + + + VF FK  ++W      LQ GYP D+   G       ID+A+ +   GKTYFF  
Sbjct: 1008DFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYN--GKTYFFIN 1181

Query: 459 DRYWRYGEEMRSMDPGYPKPI 479
           ++ WRY  + RSMDPGYPK I
Sbjct: 1182NQCWRYDNQRRSMDPGYPKSI 1244
>dbj|AK020292.1|AK020292 Mus musculus adult male cecum cDNA, RIKEN full-length enriched
           library, clone:9130404C19:matrix metalloproteinase 10,
           full insert sequence
          Length = 1735

 Score =  281 bits (720), Expect = 1e-73
 Identities = 176/468 (37%), Positives = 241/468 (50%), Gaps = 5/468 (1%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L+KY      + ++   + +  +   I  MQ+F G+ MTGK+D NT++ M KPRCGVPD
Sbjct: 162 YLEKYYNFKKNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD 341

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
              G S F            KW+  HI Y I N TP +       AI +A  VW+ VTPL
Sbjct: 342 -VGGFSTFP--------GSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPL 494

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
           TF  +        + + DI I FA G HGD  PFDG G  LAHAY PGPG  GD HFD D
Sbjct: 495 TFSRI-------SEGEADIMISFAVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDD 653

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD-NFKLPNDDLQ 284
           E WTL      G +LFLVA HELGH+LGL HS+   ++M P Y++  +  NF L  DD++
Sbjct: 654 EKWTLA---PSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIE 824

Query: 285 GIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNI 344
           GIQ +YG                   S+ P                           P+ 
Sbjct: 825 GIQSLYGAGPSSDATVVPVL------SVSPRPET-----------------------PDK 917

Query: 345 CDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NS 401
           CD   +F+++  LR E+  FKD++FWR R++   +     I+ FW  LP  +DA YE ++
Sbjct: 918 CDPALSFDSVSTLRGEVLFFKDRYFWR-RSHWNPEPEFHLISAFWPTLPSDLDAAYEAHN 1094

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
             + + FK ++FW  +   +Q GYP  + TLG       ID+A++ ++  KTYFF GD+Y
Sbjct: 1095TDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKY 1274

Query: 462 WRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKS 508
           WR+ E    MD G+P+ IT  + GI   PQ   V  E GF YF +  S
Sbjct: 1275WRFDETRHVMDKGFPRQITDDFPGI--EPQVDAVLHEFGFFYFFRGSS 1412
>ref|NM_019471.1| Mus musculus matrix metalloproteinase 10 (Mmp10), mRNA
          Length = 1744

 Score =  281 bits (720), Expect = 1e-73
 Identities = 176/468 (37%), Positives = 241/468 (50%), Gaps = 5/468 (1%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L+KY      + ++   + +  +   I  MQ+F G+ MTGK+D NT++ M KPRCGVPD
Sbjct: 150 YLEKYYNFKKNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD 329

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
              G S F            KW+  HI Y I N TP +       AI +A  VW+ VTPL
Sbjct: 330 -VGGFSTFP--------GSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPL 482

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
           TF  +        + + DI I FA G HGD  PFDG G  LAHAY PGPG  GD HFD D
Sbjct: 483 TFSRI-------SEGEADIMISFAVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDD 641

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD-NFKLPNDDLQ 284
           E WTL      G +LFLVA HELGH+LGL HS+   ++M P Y++  +  NF L  DD++
Sbjct: 642 EKWTLA---PSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIE 812

Query: 285 GIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNI 344
           GIQ +YG                   S+ P                           P+ 
Sbjct: 813 GIQSLYGAGPSSDATVVPVL------SVSPRPET-----------------------PDK 905

Query: 345 CDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NS 401
           CD   +F+++  LR E+  FKD++FWR R++   +     I+ FW  LP  +DA YE ++
Sbjct: 906 CDPALSFDSVSTLRGEVLFFKDRYFWR-RSHWNPEPEFHLISAFWPTLPSDLDAAYEAHN 1082

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
             + + FK ++FW  +   +Q GYP  + TLG       ID+A++ ++  KTYFF GD+Y
Sbjct: 1083TDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKY 1262

Query: 462 WRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKS 508
           WR+ E    MD G+P+ IT  + GI   PQ   V  E GF YF +  S
Sbjct: 1263WRFDETRHVMDKGFPRQITDDFPGI--EPQVDAVLHEFGFFYFFRGSS 1400
>emb|Y13185.1|MMMMP10 Mus musculus mRNA for stromelysin-2
          Length = 1744

 Score =  281 bits (720), Expect = 1e-73
 Identities = 176/468 (37%), Positives = 241/468 (50%), Gaps = 5/468 (1%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L+KY      + ++   + +  +   I  MQ+F G+ MTGK+D NT++ M KPRCGVPD
Sbjct: 150 YLEKYYNFKKNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD 329

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
              G S F            KW+  HI Y I N TP +       AI +A  VW+ VTPL
Sbjct: 330 -VGGFSTFP--------GSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPL 482

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
           TF  +        + + DI I FA G HGD  PFDG G  LAHAY PGPG  GD HFD D
Sbjct: 483 TFSRI-------SEGEADIMISFAVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDD 641

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD-NFKLPNDDLQ 284
           E WTL      G +LFLVA HELGH+LGL HS+   ++M P Y++  +  NF L  DD++
Sbjct: 642 EKWTLA---PSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIE 812

Query: 285 GIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNI 344
           GIQ +YG                   S+ P                           P+ 
Sbjct: 813 GIQSLYGAGPSSDATVVPVL------SVSPRPET-----------------------PDK 905

Query: 345 CDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NS 401
           CD   +F+++  LR E+  FKD++FWR R++   +     I+ FW  LP  +DA YE ++
Sbjct: 906 CDPALSFDSVSTLRGEVLFFKDRYFWR-RSHWNPEPEFHLISAFWPTLPSDLDAAYEAHN 1082

Query: 402 EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
             + + FK ++FW  +   +Q GYP  + TLG       ID+A++ ++  KTYFF GD+Y
Sbjct: 1083TDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKY 1262

Query: 462 WRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKS 508
           WR+ E    MD G+P+ IT  + GI   PQ   V  E GF YF +  S
Sbjct: 1263WRFDETRHVMDKGFPRQITDDFPGI--EPQVDAVLHEFGFFYFFRGSS 1400
>dbj|D82053.1|D82053 Cynops pyrrhogaster mRNA for stromelysin-1/2-a, complete cds
          Length = 1755

 Score =  281 bits (720), Expect = 1e-73
 Identities = 174/476 (36%), Positives = 235/476 (48%), Gaps = 4/476 (0%)
 Frame = +1

Query: 32  ATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRN 91
           AT  + E     E +L+K+ Y    D      +        +  MQ F+G+ +TGK+D N
Sbjct: 103 ATEDRGENEQLAEEYLKKF-YNLNEDGTPITRKKHSPFSEKLQEMQAFFGLEVTGKLDSN 279

Query: 92  TIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKA 151
           T++ M KPRCGV D     S F  R          W+   + Y I   TP + +A+   A
Sbjct: 280 TLEMMHKPRCGVADVAE-YSHFGGR--------PTWRTTSLTYRILGYTPDMAEADVDTA 432

Query: 152 IRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYF 211
           IRRAF VW +VTPLTF  +        +   DI I F +G HGD  PFDG  G LAHA+ 
Sbjct: 433 IRRAFKVWSDVTPLTFSRIY-------EGTADIQISFGAGVHGDFYPFDGPHGTLAHAFA 591

Query: 212 PGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYM 271
           PG  IGGD HFD DE WT G+    G +LFLVA HE GH+LGL HS D +A+M P Y Y+
Sbjct: 592 PGNSIGGDAHFDEDETWTAGSA---GYNLFLVAAHEFGHSLGLSHSGDRSALMYPTYSYI 762

Query: 272 ETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXX 331
           +   F+LP DD+ GIQ +YG                   S  P                 
Sbjct: 763 DPARFRLPQDDVDGIQALYGA------------------SPNPVPTTPQATTPTTTVSTT 888

Query: 332 XXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRG 389
               S P   P+ICD    F+ +  LR E+  FKD  FWR R   + + Y   I+  W  
Sbjct: 889 TTTTSSP-INPSICDPTLVFDAITTLRGEILFFKDSSFWR-RVPTIKEVYNYPISTSWPS 1062

Query: 390 LPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWE 448
           LP  I A YEN E + +F FK +K+W  +   + P YP ++  LG       I++A++ +
Sbjct: 1063LPSGIQAAYENPETDQIFLFKGSKYWALQGFDILPNYPKNIDKLGFPRTVKHINAAVYLQ 1242

Query: 449 DVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF 503
              KTYFF G++YW Y E  ++MD   P+ I   + GI +     F  ++NG  YF
Sbjct: 1243STQKTYFFAGEQYWSYDEARKTMDKESPRRIEDDFPGIGKKVHAVF--EDNGLLYF 1404
>gb|AF034087.1|AF034087 Equus caballus matrix metalloproteinase 13 (MMP13) mRNA, complete
           cds
          Length = 2727

 Score =  281 bits (719), Expect = 1e-73
 Identities = 180/496 (36%), Positives = 253/496 (50%), Gaps = 13/496 (2%)
 Frame = +2

Query: 38  EQYFNVEVWLQKYGYLPPTDPRMSVLRSA-ETMQSAIAAMQQFYGINMTGKVDRNTIDWM 96
           E +   E +L+ Y Y  P +P   + ++A  ++   +  MQ F+G+ +TGK+D NT+D M
Sbjct: 122 EDFQLAERYLKSYYY--PLNPAGILKKTAANSVVDRLREMQSFFGLEVTGKLDDNTLDIM 295

Query: 97  KKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
           KKPRCGVPD      ++N+  +       KW   ++ Y I N TP +  +E  KA ++AF
Sbjct: 296 KKPRCGVPDV----GEYNVFPRTL-----KWPKMNLTYRIVNYTPDLTHSEVEKAFKKAF 448

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
            VW +VTPL F       L NG    DI I F +  HGD  PFDG  G LAHA+ PGP  
Sbjct: 449 KVWSDVTPLNFTR-----LYNGT--ADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNY 607

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
           GGD HFD DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F
Sbjct: 608 GGDAHFDDDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHF 778

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
            LP+DD+QGIQ +YG                                             
Sbjct: 779 VLPDDDVQGIQYLYGPGDED---------------------------------------- 838

Query: 337 YPGAK----PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGL 390
            P  K    P+ CD   + + +  LR E  VFKD++FWR+ + +++D        FW  L
Sbjct: 839 -PNPKHPKTPDKCDPSLSLDAITSLRGETMVFKDRFFWRL-HPQLVDAELFLTKSFWPEL 1012

Query: 391 PPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWED 449
           P  IDA YE+   + +F F+  KFW      +  GYP  +  LG       I +A+ +ED
Sbjct: 1013PNRIDAAYEHPSKDLIFIFRGRKFWALNGYDILEGYPQKISELGFPKDVKKISAAVHFED 1192

Query: 450 VGKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----I 504
            GKT FF G++ WRY +  R MD  YP+ I   + GI +      V+++NG+ YF    I
Sbjct: 1193TGKTLFFSGNQVWRYDDTNRMMDKDYPRLIEEDFPGIGDKVDA--VYEKNGYIYFFNGPI 1366

Query: 505 KEKSTGNSTKMLRVEP 520
           + + +  S +++RV P
Sbjct: 1367QFEYSIWSNRIVRVMP 1414
>ref|NM_022221.1| Rattus norvegicus neutrophil collagenease (LOC63849), mRNA
          Length = 1401

 Score =  280 bits (715), Expect = 4e-73
 Identities = 172/448 (38%), Positives = 233/448 (51%), Gaps = 6/448 (1%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+K+ +LP    R +  R+A  +   +  MQ+F+G+  TGK D  TI+ M+KPRCGV
Sbjct: 109 ENYLRKFYHLPSNQFRSA--RNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGV 282

Query: 104 PDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           PD              + LT    KW H ++ Y I N TP++  AE +  I +AF +W  
Sbjct: 283 PDSGD-----------FLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSV 429

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            + LTF E     LE    + DI I F S  HGD+SPFDG  G LAHA+ PG GIGGD H
Sbjct: 430 PSTLTFTET----LEG---EADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAH 588

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FDS+E WT  + N+   +LFLVA HE GH+LGL HS DP A+M P Y Y E   + LP D
Sbjct: 589 FDSEETWTQDSKNY---NLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQD 759

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                    + P                         + 
Sbjct: 760 DINGIQTIYG---------------PSDNPVQPTG----------------------PST 828

Query: 342 PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P  CD +  F+    LR E++ FKD++FWR R+ ++       I+ FW  LP  + A YE
Sbjct: 829 PTACDPHLRFDAATTLRGEIYFFKDKYFWR-RHPQLRTVDLNFISLFWPFLPNGLQAAYE 1005

Query: 400 NSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           + + + VF FK  ++W      LQ GYP D+   G       ID+A+ +   GKTYFF  
Sbjct: 1006DFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYN--GKTYFFVN 1179

Query: 459 DRYWRYGEEMRSMDPGYPKPI-TIWKGI 485
           ++ WRY  + RSMDPGYP  I +++ GI
Sbjct: 1180NQCWRYDNQRRSMDPGYPTSIASVFPGI 1263
>emb|AJ007288.1|RNO7288 Rattus norvegicus mRNA for neutrophil collagenease
          Length = 1401

 Score =  280 bits (715), Expect = 4e-73
 Identities = 172/448 (38%), Positives = 233/448 (51%), Gaps = 6/448 (1%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+K+ +LP    R +  R+A  +   +  MQ+F+G+  TGK D  TI+ M+KPRCGV
Sbjct: 109 ENYLRKFYHLPSNQFRSA--RNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGV 282

Query: 104 PDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           PD              + LT    KW H ++ Y I N TP++  AE +  I +AF +W  
Sbjct: 283 PDSGD-----------FLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSV 429

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
            + LTF E     LE    + DI I F S  HGD+SPFDG  G LAHA+ PG GIGGD H
Sbjct: 430 PSTLTFTET----LEG---EADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAH 588

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FDS+E WT  + N+   +LFLVA HE GH+LGL HS DP A+M P Y Y E   + LP D
Sbjct: 589 FDSEETWTQDSKNY---NLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQD 759

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                    + P                         + 
Sbjct: 760 DINGIQTIYG---------------PSDNPVQPTG----------------------PST 828

Query: 342 PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P  CD +  F+    LR E++ FKD++FWR R+ ++       I+ FW  LP  + A YE
Sbjct: 829 PTACDPHLRFDAATTLRGEIYFFKDKYFWR-RHPQLRTVDLNFISLFWPFLPNGLQAAYE 1005

Query: 400 NSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           + + + VF FK  ++W      LQ GYP D+   G       ID+A+ +   GKTYFF  
Sbjct: 1006DFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYN--GKTYFFVN 1179

Query: 459 DRYWRYGEEMRSMDPGYPKPI-TIWKGI 485
           ++ WRY  + RSMDPGYP  I +++ GI
Sbjct: 1180NQCWRYDNQRRSMDPGYPTSIASVFPGI 1263
>ref|NM_002426.1| Homo sapiens matrix metalloproteinase 12 (macrophage elastase)
           (MMP12), mRNA
          Length = 1778

 Score =  279 bits (713), Expect = 7e-73
 Identities = 167/465 (35%), Positives = 240/465 (50%), Gaps = 5/465 (1%)
 Frame = +1

Query: 44  EVWLQK-YGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           E +L+K YG      P   +  S   M+  I  MQ F G+ +TG++D +T++ M  PRCG
Sbjct: 112 ERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCG 291

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPD         +   R    G  W+  +I Y I N TP +   +   AIR+AF VW NV
Sbjct: 292 VPD---------LHHFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNV 444

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPL F ++            DI ++FA G HGD   FDG+GG LAHA+ PG GIGGD HF
Sbjct: 445 TPLKFSKI-------NTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHF 603

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDD 282
           D DE WT    +  G +LFL AVHE+GH+LGL HS+DP A+M P Y+Y++ + F+L  DD
Sbjct: 604 DEDEFWTT---HSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD 774

Query: 283 LQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKP 342
           ++GIQ +YG                 ++ +P                      +   ++P
Sbjct: 775 IRGIQSLYG-------------DPKENQRLP----------------------NPDNSEP 849

Query: 343 NICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYEN 400
            +CD N  F+ +  +  ++F FKD++FW   + R      + I+  W  LP  I+A YE 
Sbjct: 850 ALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNL-ISSLWPTLPSGIEAAYEI 1026

Query: 401 SEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
              N VF FK +K+W+  +   +P YP  + + G       ID+A++     +TYFF  +
Sbjct: 1027EARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDN 1206

Query: 460 RYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           +YWRY E  + MDPGYPK IT  ++GI       F  K   + +F
Sbjct: 1207QYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFF 1341
 Score = 40.0 bits (92), Expect = 0.67
 Identities = 22/57 (38%), Positives = 32/57 (55%), Gaps = 3/57 (5%)
 Frame = +1

Query: 360  FVFKDQWFWRVRNNRVM--DGYPMQITYFWRGLPPSIDAVYENSEGNFVFFK-SNKF 413
            + F D  +WR    R M   GYP  IT  ++G+ P IDAV+ +    + FF+ SN+F
Sbjct: 1189 YFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQF 1359
>gb|L23808.1|HUMHME Human metalloproteinase (HME) mRNA, complete cds
          Length = 1778

 Score =  279 bits (713), Expect = 7e-73
 Identities = 167/465 (35%), Positives = 240/465 (50%), Gaps = 5/465 (1%)
 Frame = +1

Query: 44  EVWLQK-YGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           E +L+K YG      P   +  S   M+  I  MQ F G+ +TG++D +T++ M  PRCG
Sbjct: 112 ERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCG 291

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPD         +   R    G  W+  +I Y I N TP +   +   AIR+AF VW NV
Sbjct: 292 VPD---------LHHFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNV 444

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPL F ++            DI ++FA G HGD   FDG+GG LAHA+ PG GIGGD HF
Sbjct: 445 TPLKFSKI-------NTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHF 603

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDD 282
           D DE WT    +  G +LFL AVHE+GH+LGL HS+DP A+M P Y+Y++ + F+L  DD
Sbjct: 604 DEDEFWTT---HSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD 774

Query: 283 LQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKP 342
           ++GIQ +YG                 ++ +P                      +   ++P
Sbjct: 775 IRGIQSLYG-------------DPKENQRLP----------------------NPDNSEP 849

Query: 343 NICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYEN 400
            +CD N  F+ +  +  ++F FKD++FW   + R      + I+  W  LP  I+A YE 
Sbjct: 850 ALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNL-ISSLWPTLPSGIEAAYEI 1026

Query: 401 SEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
              N VF FK +K+W+  +   +P YP  + + G       ID+A++     +TYFF  +
Sbjct: 1027EARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDN 1206

Query: 460 RYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           +YWRY E  + MDPGYPK IT  ++GI       F  K   + +F
Sbjct: 1207QYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFF 1341
 Score = 40.0 bits (92), Expect = 0.67
 Identities = 22/57 (38%), Positives = 32/57 (55%), Gaps = 3/57 (5%)
 Frame = +1

Query: 360  FVFKDQWFWRVRNNRVM--DGYPMQITYFWRGLPPSIDAVYENSEGNFVFFK-SNKF 413
            + F D  +WR    R M   GYP  IT  ++G+ P IDAV+ +    + FF+ SN+F
Sbjct: 1189 YFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQF 1359
>emb|X05083.1|RNTRAN2R RAT mRNA for oncogene-induced transin-2
          Length = 1708

 Score =  278 bits (710), Expect = 1e-72
 Identities = 178/477 (37%), Positives = 242/477 (50%), Gaps = 5/477 (1%)
 Frame = +2

Query: 32  ATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRN 91
           +T+  A+QY      L+KY      + +    + +  +   I  MQ+F G+ MTGK+D N
Sbjct: 119 STMDLAQQY------LEKYYNFRKNEKQFFKRKDSSPVVKKIEEMQKFLGLEMTGKLDSN 280

Query: 92  TIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKA 151
           T++ M KPRCGVPD   G S F            KW+  HI+Y I N T  +       A
Sbjct: 281 TVEMMHKPRCGVPD-VGGFSTFP--------GSPKWRKNHISYRIVNYTLDLPRESVDSA 433

Query: 152 IRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYF 211
           I RA  VW+ VTPLTF  +        + + DI I FA G HGD  PFDG G  LAHAY 
Sbjct: 434 IERALKVWEEVTPLTFSRI-------SEGEADIMISFAVGEHGDFYPFDGVGQSLAHAYP 592

Query: 212 PGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYM 271
           PGPG  GD HFD DE W+LG     G +LFLVA HELGH+LGL HSN+  ++M P Y++ 
Sbjct: 593 PGPGFYGDAHFDDDEKWSLG---PSGTNLFLVAAHELGHSLGLFHSNNKESLMYPVYRFS 763

Query: 272 ETD-NFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXX 330
            +  N +L  DD++GIQ +YG                   ++ P                
Sbjct: 764 TSQANIRLSQDDIEGIQSLYGARPSSDA------------TVVPV--------------- 862

Query: 331 XXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWR 388
                S     P  CD   +F+ + +LR E   FKD+ FWR         + + I+ FW 
Sbjct: 863 --PSVSPKPETPVKCDPALSFDAVTMLRGEFLFFKDRHFWRRTQWNPEPEFHL-ISAFWP 1033

Query: 389 GLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWW 447
            LP  +DA YE N++   + FK ++FW  +   +Q GYP  + TLG       ID+A++ 
Sbjct: 1034SLPSGLDAAYEANNKDRVLIFKGSQFWAVRGNEVQAGYPKRIHTLGFPPTVKKIDAAVFE 1213

Query: 448 EDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           ++  KTYFF GD+YWR+ E  + MD G+P+ IT  + GI   PQ   V    GF YF
Sbjct: 1214KEKKKTYFFVGDKYWRFDETRQLMDKGFPRLITDDFPGI--EPQVDAVLHAFGFFYF 1378
>gb|M65253.1|RATTAP34A Rat transformation-associated protein (34A) mRNA, complete cds
          Length = 1717

 Score =  278 bits (710), Expect = 1e-72
 Identities = 178/477 (37%), Positives = 242/477 (50%), Gaps = 5/477 (1%)
 Frame = +2

Query: 32  ATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRN 91
           +T+  A+QY      L+KY      + +    + +  +   I  MQ+F G+ MTGK+D N
Sbjct: 122 STMDLAQQY------LEKYYNFRKNEKQFFKRKDSSPVVKKIEEMQKFLGLEMTGKLDSN 283

Query: 92  TIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKA 151
           T++ M KPRCGVPD   G S F            KW+  HI+Y I N T  +       A
Sbjct: 284 TVEMMHKPRCGVPD-VGGFSTFP--------GSPKWRKNHISYRIVNYTLDLPRESVDSA 436

Query: 152 IRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYF 211
           I RA  VW+ VTPLTF  +        + + DI I FA G HGD  PFDG G  LAHAY 
Sbjct: 437 IERALKVWEEVTPLTFSRI-------SEGEADIMISFAVGEHGDFYPFDGVGQSLAHAYP 595

Query: 212 PGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYM 271
           PGPG  GD HFD DE W+LG     G +LFLVA HELGH+LGL HSN+  ++M P Y++ 
Sbjct: 596 PGPGFYGDAHFDDDEKWSLG---PSGTNLFLVAAHELGHSLGLFHSNNKESLMYPVYRFS 766

Query: 272 ETD-NFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXX 330
            +  N +L  DD++GIQ +YG                   ++ P                
Sbjct: 767 TSQANIRLSQDDIEGIQSLYGARPSSDA------------TVVPV--------------- 865

Query: 331 XXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWR 388
                S     P  CD   +F+ + +LR E   FKD+ FWR         + + I+ FW 
Sbjct: 866 --PSVSPKPETPVKCDPALSFDAVTMLRGEFLFFKDRHFWRRTQWNPEPEFHL-ISAFWP 1036

Query: 389 GLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWW 447
            LP  +DA YE N++   + FK ++FW  +   +Q GYP  + TLG       ID+A++ 
Sbjct: 1037SLPSGLDAAYEANNKDRVLIFKGSQFWAVRGNEVQAGYPKRIHTLGFPPTVKKIDAAVFE 1216

Query: 448 EDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           ++  KTYFF GD+YWR+ E  + MD G+P+ IT  + GI   PQ   V    GF YF
Sbjct: 1217KEKKKTYFFVGDKYWRFDETRQLMDKGFPRLITDDFPGI--EPQVDAVLHAFGFFYF 1381
>gb|AF148882.1|AF148882 Equus caballus matrix metalloproteinase 1 precursor (MMP1) mRNA,
           complete cds
          Length = 1923

 Score =  277 bits (709), Expect = 2e-72
 Identities = 176/469 (37%), Positives = 237/469 (50%), Gaps = 8/469 (1%)
 Frame = +2

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+ Y  L     ++   R    +   +  MQ+F+G+ +TGK D  T++ MK+PRCG
Sbjct: 155 VQKYLENYYNLKSDGEQIEKQRHRSPVVEKLKQMQEFFGLKVTGKPDAETLNVMKQPRCG 334

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD              + LT    +W++ H+ Y I+N TP +  A+  +AI +AF +W 
Sbjct: 335 VPDVAE-----------FVLTEGNPRWENTHLTYRIENYTPDLPRADVDQAIEKAFQLWS 481

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NV+PLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGP IGGD 
Sbjct: 482 NVSPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPRIGGDA 640

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N+   +L+ VA HE GH+LGL HS D  A+M P   Y  T + +L  
Sbjct: 641 HFDEDETWTSNFRNY---NLYRVAAHEFGHSLGLSHSTDIGALMYP--NYFFTGDVQLSQ 805

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                    I P                          
Sbjct: 806 DDINGIQAIYG---------------PSQNPIQPIGPQT--------------------- 877

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
            P +CD    F+ +  +R E+  FKD+++ R+ N    +     I+ FW  LP  + A Y
Sbjct: 878 -PEVCDSKLTFDAITTIRGEVMFFKDRFYMRI-NPYYPEAELNFISIFWPQLPNGLQAAY 1051

Query: 399 ENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTYF 455
           E S  + V FFK NK+W  K   +  GYP D I    G PS    ID+A+  ED GKTYF
Sbjct: 1052EVSHRDEVRFFKGNKYWAVKGQDVLYGYPKD-IHRSFGFPSTVKNIDAAVSEEDTGKTYF 1228

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           F  D+YWRY E  RSMD GYPK I   + GI +     F  +++GF YF
Sbjct: 1229FVADKYWRYDEYKRSMDAGYPKMIADDFPGIGDKVDAVF--QKDGFFYF 1369
>gb|AF201729.1|AF201729 Canis familiaris matrix metalloproteinase-13 mRNA, partial cds
          Length = 1356

 Score =  276 bits (706), Expect = 4e-72
 Identities = 171/471 (36%), Positives = 239/471 (50%), Gaps = 5/471 (1%)
 Frame = +1

Query: 38  EQYFNVEVWLQKYGYLPPTDPRMSVLRSAE-TMQSAIAAMQQFYGINMTGKVDRNTIDWM 96
           E +   E +L+ Y Y  P +P   + +SA  ++   +  MQ F+G+ +TGK+D NT+D M
Sbjct: 76  EDFQLAERYLKSYYY--PLNPAGILKKSAAGSVADRLREMQSFFGLEVTGKLDDNTLDIM 249

Query: 97  KKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
           KKPRCGVPD      ++N+  +       KW   ++ Y I N TP +  +E  KA ++AF
Sbjct: 250 KKPRCGVPDV----GEYNVFPRTL-----KWSKTNLTYRIVNYTPDLTHSEVEKAFKKAF 402

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
            VW +VTPL F       L +G    DI I F +  HGD  PFDG  G LAHA+ PGP  
Sbjct: 403 KVWSDVTPLNFTR-----LHDGT--ADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNY 561

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
           GGD HFD DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F
Sbjct: 562 GGDAHFDDDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHF 732

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
            LP+DD+QGIQ +YG                                             
Sbjct: 733 MLPDDDVQGIQSLYG------------------------------------PGDEDPNPR 804

Query: 337 YPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSI 394
           +P   P+ CD   + + +  LR E  +FKD++FWR+   +V D        FW  LP  I
Sbjct: 805 HP-KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQV-DAELFLTKSFWPELPNRI 978

Query: 395 DAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DA YE+   + +F F+  K+W      +  GYP  +  LG       I +A+ +ED GKT
Sbjct: 979 DAAYEHPSRDLIFIFRGRKYWALNGYDILEGYPQKISELGFPKEVKKISAAVHFEDTGKT 1158

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF 503
            FF G++ W Y +  + MD  YP+ I   + GI +      V+++NG+ YF
Sbjct: 1159LFFSGNQVWSYDDTNQIMDKDYPRLIEEDFPGIGDKVDA--VYEKNGYIYF 1305
>emb|X05232.1|HSSTROMR Human mRNA for stromelysin
          Length = 1801

 Score =  275 bits (703), Expect = 9e-72
 Identities = 178/496 (35%), Positives = 246/496 (48%), Gaps = 16/496 (3%)
 Frame = +2

Query: 29  ILCATVCKA----------EQYFN-VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC  VC A          +   N V+ +L+ Y  L     +    + +  +   I  MQ
Sbjct: 68  LLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQ 247

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M+KPRCGVPD     +   I          KW+  H+ Y I 
Sbjct: 248 KFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGI---------PKWRKTHLTYRIV 400

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N TP +       A+ +A  VW+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 401 NYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLY-------EGEADIMISFAVREHGDFY 559

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
           PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HE+GH+LGL HS
Sbjct: 560 PFDGPGNVLAHAYAPGPGINGDAHFDDDEQWT---KDTTGTNLFLVAAHEIGHSLGLFHS 730

Query: 258 NDPTAIMAPFYQYM-ETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  + +   F+L  DD+ GIQ +YG                    +PP  
Sbjct: 731 ANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPT-----EPVPPE- 892

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNR 374
                                PG   N CD   +F+ +  LR E+ +FKD+ FWR ++ R
Sbjct: 893 ---------------------PGTPAN-CDPALSFDAVSTLRGEILIFKDRHFWR-KSLR 1003

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLG 433
            ++     I+ FW  LP  +DA YE +  + VF FK N+FW  +   ++ GYP  + TLG
Sbjct: 1004KLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLG 1183

Query: 434 SGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGA 492
                  ID+AI  ++  KTYFF  D+YWR+ E+  SM+PG+PK I   + GI       
Sbjct: 1184FPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAV 1363

Query: 493 FVHKENGFTYFIKEKS 508
           F  +E GF YF    S
Sbjct: 1364F--EEFGFFYFFTGSS 1405
 Score = 58.5 bits (140), Expect = 2e-06
 Identities = 48/151 (31%), Positives = 71/151 (46%), Gaps = 5/151 (3%)
 Frame = +2

Query: 393  SIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGK 452
            S DAV     G  + FK   FW      L+P   H + +    +PS G+D+A        
Sbjct: 926  SFDAV-STLRGEILIFKDRHFWRKSLRKLEPEL-HLISSFWPSLPS-GVDAAYEVTSKDL 1096

Query: 453  TYFFKGDRYWRY-GEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEK 507
             + FKG+++W   G E+R+   GYP+ I    G P + +    A   KE   TYF +++K
Sbjct: 1097 VFIFKGNQFWAIRGNEVRA---GYPRGIHTL-GFPPTVRKIDAAISDKEKNKTYFFVEDK 1264

Query: 508  STGNSTKMLRVEPGYPRSILKDFMGCDGPTD 538
                  K   +EPG+P+ I +DF G D   D
Sbjct: 1265 YWRFDEKRNSMEPGFPKQIAEDFPGIDSKID 1357
>ref|NM_002422.2| Homo sapiens matrix metalloproteinase 3 (stromelysin 1,
           progelatinase) (MMP3), mRNA
          Length = 1821

 Score =  275 bits (703), Expect = 9e-72
 Identities = 178/496 (35%), Positives = 246/496 (48%), Gaps = 16/496 (3%)
 Frame = +1

Query: 29  ILCATVCKA----------EQYFN-VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC  VC A          +   N V+ +L+ Y  L     +    + +  +   I  MQ
Sbjct: 88  LLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQ 267

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M+KPRCGVPD     +   I          KW+  H+ Y I 
Sbjct: 268 KFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGI---------PKWRKTHLTYRIV 420

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N TP +       A+ +A  VW+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 421 NYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLY-------EGEADIMISFAVREHGDFY 579

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
           PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HE+GH+LGL HS
Sbjct: 580 PFDGPGNVLAHAYAPGPGINGDAHFDDDEQWT---KDTTGTNLFLVAAHEIGHSLGLFHS 750

Query: 258 NDPTAIMAPFYQYM-ETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  + +   F+L  DD+ GIQ +YG                    +PP  
Sbjct: 751 ANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPT-----EPVPPE- 912

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNR 374
                                PG   N CD   +F+ +  LR E+ +FKD+ FWR ++ R
Sbjct: 913 ---------------------PGTPAN-CDPALSFDAVSTLRGEILIFKDRHFWR-KSLR 1023

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLG 433
            ++     I+ FW  LP  +DA YE +  + VF FK N+FW  +   ++ GYP  + TLG
Sbjct: 1024KLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLG 1203

Query: 434 SGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGA 492
                  ID+AI  ++  KTYFF  D+YWR+ E+  SM+PG+PK I   + GI       
Sbjct: 1204FPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAV 1383

Query: 493 FVHKENGFTYFIKEKS 508
           F  +E GF YF    S
Sbjct: 1384F--EEFGFFYFFTGSS 1425
 Score = 58.5 bits (140), Expect = 2e-06
 Identities = 48/151 (31%), Positives = 71/151 (46%), Gaps = 5/151 (3%)
 Frame = +1

Query: 393  SIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGK 452
            S DAV     G  + FK   FW      L+P   H + +    +PS G+D+A        
Sbjct: 946  SFDAV-STLRGEILIFKDRHFWRKSLRKLEPEL-HLISSFWPSLPS-GVDAAYEVTSKDL 1116

Query: 453  TYFFKGDRYWRY-GEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEK 507
             + FKG+++W   G E+R+   GYP+ I    G P + +    A   KE   TYF +++K
Sbjct: 1117 VFIFKGNQFWAIRGNEVRA---GYPRGIHTL-GFPPTVRKIDAAISDKEKNKTYFFVEDK 1284

Query: 508  STGNSTKMLRVEPGYPRSILKDFMGCDGPTD 538
                  K   +EPG+P+ I +DF G D   D
Sbjct: 1285 YWRFDEKRNSMEPGFPKQIAEDFPGIDSKID 1377
>gb|J03209.1|HUMMMP3A Human matrix metalloproteinase-3 (MMP-3) mRNA, complete cds
          Length = 1434

 Score =  275 bits (703), Expect = 9e-72
 Identities = 178/496 (35%), Positives = 246/496 (48%), Gaps = 16/496 (3%)
 Frame = +1

Query: 29  ILCATVCKA----------EQYFN-VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC  VC A          +   N V+ +L+ Y  L     +    + +  +   I  MQ
Sbjct: 25  LLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQ 204

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M+KPRCGVPD     +   I          KW+  H+ Y I 
Sbjct: 205 KFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGI---------PKWRKTHLTYRIV 357

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N TP +       A+ +A  VW+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 358 NYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLY-------EGEADIMISFAVREHGDFY 516

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
           PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HE+GH+LGL HS
Sbjct: 517 PFDGPGNVLAHAYAPGPGINGDAHFDDDEQWT---KDTTGTNLFLVAAHEIGHSLGLFHS 687

Query: 258 NDPTAIMAPFYQYM-ETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  + +   F+L  DD+ GIQ +YG                    +PP  
Sbjct: 688 ANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPT-----EPVPPE- 849

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNR 374
                                PG   N CD   +F+ +  LR E+ +FKD+ FWR ++ R
Sbjct: 850 ---------------------PGTPAN-CDPALSFDAVSTLRGEILIFKDRHFWR-KSLR 960

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLG 433
            ++     I+ FW  LP  +DA YE +  + VF FK N+FW  +   ++ GYP  + TLG
Sbjct: 961 KLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLG 1140

Query: 434 SGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGA 492
                  ID+AI  ++  KTYFF  D+YWR+ E+  SM+PG+PK I   + GI       
Sbjct: 1141FPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAV 1320

Query: 493 FVHKENGFTYFIKEKS 508
           F  +E GF YF    S
Sbjct: 1321F--EEFGFFYFFTGSS 1362
 Score = 58.5 bits (140), Expect = 2e-06
 Identities = 48/151 (31%), Positives = 71/151 (46%), Gaps = 5/151 (3%)
 Frame = +1

Query: 393  SIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGK 452
            S DAV     G  + FK   FW      L+P   H + +    +PS G+D+A        
Sbjct: 883  SFDAV-STLRGEILIFKDRHFWRKSLRKLEPEL-HLISSFWPSLPS-GVDAAYEVTSKDL 1053

Query: 453  TYFFKGDRYWRY-GEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEK 507
             + FKG+++W   G E+R+   GYP+ I    G P + +    A   KE   TYF +++K
Sbjct: 1054 VFIFKGNQFWAIRGNEVRA---GYPRGIHTL-GFPPTVRKIDAAISDKEKNKTYFFVEDK 1221

Query: 508  STGNSTKMLRVEPGYPRSILKDFMGCDGPTD 538
                  K   +EPG+P+ I +DF G D   D
Sbjct: 1222 YWRFDEKRNSMEPGFPKQIAEDFPGIDSKID 1314
>emb|X75308.1|HSRNAC3 H.sapiens mRNA for collagenase 3
          Length = 2698

 Score =  275 bits (702), Expect = 1e-71
 Identities = 176/489 (35%), Positives = 243/489 (48%), Gaps = 12/489 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+ Y Y P     +    +A +M   +  MQ F+G+ +TGK+D NT+D MKKPRCGV
Sbjct: 122 ERYLRSY-YHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGV 298

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD      ++N+  +       KW   ++ Y I N TP +  +E  KA ++AF VW +VT
Sbjct: 299 PDV----GEYNVFPRTL-----KWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVT 451

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F       L +G    DI I F    HGD  PFDG  G LAHA+ PGP  GGD HFD
Sbjct: 452 PLNFTR-----LHDGI--ADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFD 610

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F LP+DD+
Sbjct: 611 DDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV 781

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-- 341
           QGIQ +YG                                              P  K  
Sbjct: 782 QGIQSLYGPGDED-----------------------------------------PNPKHP 838

Query: 342 --PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P+ CD   + + +  LR E  +FKD++FWR+   +V D        FW  LP  IDA 
Sbjct: 839 KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQV-DAELFLTKSFWPELPNRIDAA 1015

Query: 398 YENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+   + +F F+  KFW      +  GYP  +  LG       I +A+ +ED GKT  F
Sbjct: 1016YEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLF 1195

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----IKEKSTGN 511
            G++ WRY +    MD  YP+ I   + GI +      V+++NG+ YF    I+ + +  
Sbjct: 1196SGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDA--VYEKNGYIYFFNGPIQFEYSIW 1369

Query: 512 STKMLRVEP 520
           S +++RV P
Sbjct: 1370SNRIVRVMP 1396
>ref|NM_002427.2| Homo sapiens matrix metalloproteinase 13 (collagenase 3) (MMP13),
           mRNA
          Length = 2722

 Score =  275 bits (702), Expect = 1e-71
 Identities = 176/489 (35%), Positives = 243/489 (48%), Gaps = 12/489 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+ Y Y P     +    +A +M   +  MQ F+G+ +TGK+D NT+D MKKPRCGV
Sbjct: 146 ERYLRSY-YHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGV 322

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD      ++N+  +       KW   ++ Y I N TP +  +E  KA ++AF VW +VT
Sbjct: 323 PDV----GEYNVFPRTL-----KWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVT 475

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F       L +G    DI I F    HGD  PFDG  G LAHA+ PGP  GGD HFD
Sbjct: 476 PLNFTR-----LHDGI--ADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFD 634

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F LP+DD+
Sbjct: 635 DDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV 805

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-- 341
           QGIQ +YG                                              P  K  
Sbjct: 806 QGIQSLYGPGDED-----------------------------------------PNPKHP 862

Query: 342 --PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P+ CD   + + +  LR E  +FKD++FWR+   +V D        FW  LP  IDA 
Sbjct: 863 KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQV-DAELFLTKSFWPELPNRIDAA 1039

Query: 398 YENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+   + +F F+  KFW      +  GYP  +  LG       I +A+ +ED GKT  F
Sbjct: 1040YEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLF 1219

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----IKEKSTGN 511
            G++ WRY +    MD  YP+ I   + GI +      V+++NG+ YF    I+ + +  
Sbjct: 1220SGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDA--VYEKNGYIYFFNGPIQFEYSIW 1393

Query: 512 STKMLRVEP 520
           S +++RV P
Sbjct: 1394SNRIVRVMP 1420
>emb|X81334.1|HSCOLLAG3 H.sapiens mRNA for collagenase-3 protein
          Length = 1946

 Score =  275 bits (702), Expect = 1e-71
 Identities = 176/489 (35%), Positives = 243/489 (48%), Gaps = 12/489 (2%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+ Y Y P     +    +A +M   +  MQ F+G+ +TGK+D NT+D MKKPRCGV
Sbjct: 145 ERYLRSY-YHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGV 321

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD      ++N+  +       KW   ++ Y I N TP +  +E  KA ++AF VW +VT
Sbjct: 322 PDV----GEYNVFPRTL-----KWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVT 474

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F       L +G    DI I F    HGD  PFDG  G LAHA+ PGP  GGD HFD
Sbjct: 475 PLNFTR-----LHDGI--ADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFD 633

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F LP+DD+
Sbjct: 634 DDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV 804

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-- 341
           QGIQ +YG                                              P  K  
Sbjct: 805 QGIQSLYGPGDED-----------------------------------------PNPKHP 861

Query: 342 --PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P+ CD   + + +  LR E  +FKD++FWR+   +V D        FW  LP  IDA 
Sbjct: 862 KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQV-DAELFLTKSFWPELPNRIDAA 1038

Query: 398 YENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+   + +F F+  KFW      +  GYP  +  LG       I +A+ +ED GKT  F
Sbjct: 1039YEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLF 1218

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----IKEKSTGN 511
            G++ WRY +    MD  YP+ I   + GI +      V+++NG+ YF    I+ + +  
Sbjct: 1219SGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDA--VYEKNGYIYFFNGPIQFEYSIW 1392

Query: 512 STKMLRVEP 520
           S +++RV P
Sbjct: 1393SNRIVRVMP 1419
>emb|Z27093.1|XLSTROL3 X.laevis mRNA for stromelysin-3
          Length = 2890

 Score =  274 bits (700), Expect = 2e-71
 Identities = 160/440 (36%), Positives = 220/440 (49%), Gaps = 5/440 (1%)
 Frame = +3

Query: 99  PRCGVPD--QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
           PRCGVPD      SS    R+KR+ L+G +W   ++ Y I     ++   + R+ I  A 
Sbjct: 399 PRCGVPDIPAPPDSSSGRNRQKRFVLSGGRWDKTNLTYKIIRFPWQLSKVKVRRTIAEAL 578

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
            VW  VTPLTF EV       G+ D  I I F   +HGD+ PFDG GG LAHA+FP    
Sbjct: 579 KVWSEVTPLTFTEV-----HEGRSD--IIIDFTRYWHGDNLPFDGPGGILAHAFFPKTHR 737

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
            GD HFD DE WT+G  N+ G DL  VA HE GH LGL+HS+   ++M+PFY +      
Sbjct: 738 EGDVHFDYDEAWTIG--NNIGTDLLQVAAHEFGHMLGLQHSSISKSLMSPFYTFRYP--L 905

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
            L  DD  GIQ +YG                      P                      
Sbjct: 906 SLSADDKHGIQFLYGA---------------------PRPPTPSPTPRVEVNQVENESNE 1022

Query: 337 YPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDA 396
            P A+P+ C  NF+ +  +R E+F FK  + WR+R  ++ +GYP   +  WRG+P ++DA
Sbjct: 1023IPAAEPDACKTNFDAVSTIRGELFFFKSGYVWRLRGGKLQNGYPALASRHWRGIPDTVDA 1202

Query: 397 VYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWW--EDVGKTY 454
            +E+S GN  FF  ++FWVF D  LQ   P  +  +G  +    I +A  W  E   KTY
Sbjct: 1203AFEDSVGNIWFFYGSQFWVF-DGKLQASGPFPITDIGISVTQ--IQAAFVWGTEKNKKTY 1373

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK 514
            F+G  YWR+  E R ++  + + I  W+G+P+    AF   E G+ YF+K +       
Sbjct: 1374LFRGGEYWRFNPETRRVESRHSRRIGDWRGVPKGIDAAF-QDEQGYAYFVKGRQYWKFDP 1550

Query: 515 M-LRVEPGYPRSILKDFMGC 533
             +RV  GYP  I +DF  C
Sbjct: 1551FKVRVMDGYPHLISQDFFNC 1610
>gb|U41824.1|XLU41824 Xenopus laevis collagenase-3 (gene A) mRNA, complete cds
          Length = 2960

 Score =  274 bits (700), Expect = 2e-71
 Identities = 165/445 (37%), Positives = 233/445 (52%), Gaps = 4/445 (0%)
 Frame = +1

Query: 63  LRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYAL 122
           ++   ++++ +  MQ F+G+ +TGK++ +T+D MK+PRCGVPD   G   F  R+     
Sbjct: 184 MKDVNSVETKLKEMQSFFGLEVTGKLNEDTLDIMKQPRCGVPDV--GQYNFFPRKL---- 345

Query: 123 TGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDV 182
              KW   ++ Y I N TP +  ++  +AI++A  VW +VTPL F       L  G    
Sbjct: 346 ---KWPRNNLTYRIVNYTPDLSTSDVDRAIKKALKVWSDVTPLNFTR-----LRTGT--A 495

Query: 183 DITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFL 242
           DI + F    HGD  PFDG  G LAHA+ PG  IGGDTHFD DE ++  N    G +LF+
Sbjct: 496 DIMVAFGKKEHGDYYPFDGPDGLLAHAFPPGEKIGGDTHFDDDEMFSTDNK---GYNLFV 666

Query: 243 VAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXX 302
           VA HE GHALGL+HS DP ++M P Y Y ET  F LP+DD+QGIQ +YG           
Sbjct: 667 VAAHEFGHALGLDHSRDPGSLMFPVYTYTETSRFVLPDDDVQGIQALYG----------- 813

Query: 303 XXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMF 360
                 +R   P                      +P   P  CD +   + +  LR E  
Sbjct: 814 ----SGNRDPHP---------------------KHP-KTPEKCDPDLTIDAITELRGEKM 915

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDT 419
           +FKD++FWRV + ++ D   + I  FW  LP  IDA YE+   + ++ F+  KFW     
Sbjct: 916 IFKDRFFWRV-HPQMTDAELVLIKSFWPELPNKIDAAYEHPAKDLIYIFRGKKFWALNGY 1092

Query: 420 TLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI 479
                YP  L  LG       ID+A++ + +GKT FF  D YW + EE R+MD G+P+ I
Sbjct: 1093DFVEDYPKKLHELGFPKTLKAIDAAVYNKAIGKTLFFAEDSYWSFDEEARTMDKGFPRLI 1272

Query: 480 T-IWKGIPESPQGAFVHKENGFTYF 503
           +  + GI E    A+  + NG+ YF
Sbjct: 1273SEDFPGIGEKVDAAY--QRNGYIYF 1341
>gb|L49412.1|XELMMP1G Xenopus laevis collagenase 3 (MMP-13) mRNA, 3' end of cds
          Length = 2850

 Score =  273 bits (699), Expect = 3e-71
 Identities = 164/445 (36%), Positives = 235/445 (51%), Gaps = 4/445 (0%)
 Frame = +1

Query: 63  LRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYAL 122
           +++  ++++ +  MQ F+G+ +TGK++ +T+D MK+PRCGVPD   G   F  R+     
Sbjct: 166 MKNVNSIETKLKEMQSFFGLEVTGKLNEDTLDIMKQPRCGVPDV--GQYNFFPRKL---- 327

Query: 123 TGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDV 182
              KW   ++ Y I N TP +  +E  +AI++A  VW +VTPL F       L  G    
Sbjct: 328 ---KWPRNNLTYRIVNYTPDLSTSEVDRAIKKALKVWSDVTPLNFTR-----LRTGT--A 477

Query: 183 DITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFL 242
           DI + F    HGD  PFDG  G LAHA+ PG  +GGDTHFD DE ++  N    G +LF+
Sbjct: 478 DIMVSFGKKEHGDYYPFDGPDGLLAHAFPPGEKLGGDTHFDDDEMFSTDNK---GYNLFV 648

Query: 243 VAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXX 302
           VA HE GHALGL+HS DP ++M P Y Y ET  F LP+DD+QGIQ +YG           
Sbjct: 649 VAAHEFGHALGLDHSRDPGSLMFPVYTYTETSRFVLPDDDVQGIQVLYG----------- 795

Query: 303 XXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMF 360
                 +R   P                      +P   P  CD   + + +  LR E  
Sbjct: 796 ----PGNRDPHP---------------------KHP-KTPEKCDPDLSIDAITELRGEKM 897

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDT 419
           +FKD++FWRV + ++ D   + I  FW  LP  +DA YE+   +  + F+  KFW     
Sbjct: 898 IFKDRFFWRV-HPQMTDAELVLIKSFWPELPNKLDAAYEHPAKDLSYLFRGKKFWALNGY 1074

Query: 420 TLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI 479
            +   YP  L  LG       ID+A++ +D GKT+FF  D YW + EE R++D G+P+ I
Sbjct: 1075DIVEDYPKKLHELGFPKTLKAIDAAVYNKDTGKTFFFTEDSYWSFDEEARTLDKGFPRLI 1254

Query: 480 T-IWKGIPESPQGAFVHKENGFTYF 503
           +  + GI E    A+  + NG+ YF
Sbjct: 1255SEDFPGIGEKVDAAY--QRNGYLYF 1323
>gb|AF059201.1|AF059201 Oryctolagus cuniculus collagenase-3 precursor, mRNA, complete cds
          Length = 3124

 Score =  273 bits (698), Expect = 4e-71
 Identities = 171/474 (36%), Positives = 234/474 (49%), Gaps = 8/474 (1%)
 Frame = +1

Query: 38   EQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMK 97
            E +   E +L+ Y Y P     +    +A +M   +  MQ F+G+ +TGK+D NT+  MK
Sbjct: 766  EDFQFAESYLRSY-YHPLNPAGILKKNAAGSMVDRLREMQSFFGLEVTGKLDDNTLAIMK 942

Query: 98   KPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFD 157
            +PRCGVPD      ++N+  +       KW   ++ Y I N TP +  +E  KA ++AF 
Sbjct: 943  QPRCGVPDV----GEYNVFPRTL-----KWSQTNLTYRIVNYTPDLTHSEVEKAFKKAFK 1095

Query: 158  VWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG 217
            VW +VTPL F  +      NG    DI I F +  HGD  PFDG  G LAHA+ PGP  G
Sbjct: 1096 VWSDVTPLNFTRI-----HNGT--ADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYG 1254

Query: 218  GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFK 277
            GD HFD DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F 
Sbjct: 1255 GDAHFDDDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFM 1425

Query: 278  LPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSY 337
            LP+DD+QGIQ +YG                                              
Sbjct: 1426 LPDDDVQGIQSLYGPGDED----------------------------------------- 1482

Query: 338  PGAK----PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLP 391
            P  K    P+ CD   + + +  LR E  +FKD++FWR+   +V D        FW  LP
Sbjct: 1483 PNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQV-DAELFLTKSFWPELP 1659

Query: 392  PSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDV 450
              IDA YE+   + +F F+  KFW      +  GYP  L  LG       I +A+ +ED 
Sbjct: 1660 NRIDAAYEHPARDLIFIFRGKKFWAPNGYDILEGYPQKLSELGFPREVKKISAAVHFEDT 1839

Query: 451  GKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF 503
            GKT FF G++ W Y +   +MD  YP+ I   + GI        V+++NG+ YF
Sbjct: 1840 GKTLFFSGNQVWSYDDTNHTMDQDYPRLIEEEFPGIGGKVDA--VYEKNGYIYF 1995
>dbj|D82055.1|D82055 Cynops pyrrhogaster mRNA for collagenase 3, complete cds
          Length = 3981

 Score =  273 bits (698), Expect = 4e-71
 Identities = 170/464 (36%), Positives = 245/464 (52%), Gaps = 9/464 (1%)
 Frame = +1

Query: 64  RSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT 123
           +    + S +  MQ F+ + +TGK+D +T++ MK+PRCGVPD      ++N+  +     
Sbjct: 187 KGGNALASKLREMQSFFDLEVTGKLDEDTLEVMKQPRCGVPDV----GEYNVFPRSL--- 345

Query: 124 GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVD 183
             KW   ++ Y I+N TP +  AE  +AI++AF VW  VTPL F       L +G    D
Sbjct: 346 --KWPRFNLTYRIENYTPDMTHAEVDRAIKKAFRVWSEVTPLNFTR-----LRSGT--AD 498

Query: 184 ITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLV 243
           I I F +  HGD  PFDG  G LAHA+ PG  IGGDTHFD DE +T G+   +G +LF+V
Sbjct: 499 IMISFGTKEHGDFYPFDGPNGLLAHAFPPGQRIGGDTHFDDDETFTSGS---NGYNLFIV 669

Query: 244 AVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXX 303
           A HE GHALGL+HS DP ++M P Y Y E   F LP+DD+QGIQ +YG            
Sbjct: 670 AAHEFGHALGLDHSRDPGSLMYPVYSYTEPSRFLLPDDDVQGIQSLYG------------ 813

Query: 304 XXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMFV 361
                +R   P                      +P   P  CD   + + +  +R E  +
Sbjct: 814 ---PGNRDPNP---------------------KHP-KTPEKCDPELSLDAITEMRGEKLI 918

Query: 362 FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTT 420
           FKD++FWR ++ ++ D   + I  FW  LP  IDA YE  E + ++ F+  KFW      
Sbjct: 919 FKDRFFWR-QHPQMTDVELVLIRNFWPELPSKIDAAYEYPEKDLIYIFRGRKFWALNGYD 1095

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT 480
           +   YP  +  LG       ID+A++   +GKT FF G++YW + EE ++++ GYP+ I 
Sbjct: 1096ILADYPKKIQELGFPKSLRTIDAAVYNRAMGKTLFFTGEKYWSFDEEKQTVEKGYPRFIA 1275

Query: 481 -IWKGIPESPQGAFVHKENGFTYFIK-----EKSTGNSTKMLRV 518
             + GI E+   A+  + NG+ YF       E ST  S K++RV
Sbjct: 1276DDFPGIGETVDAAY--QRNGYIYFFSGSLQFEYSTW-SNKVIRV 1398
>emb|X54925.1|HSCOLL1 H.sapiens mRNA for type I interstitial collagenase
          Length = 1970

 Score =  272 bits (696), Expect = 6e-71
 Identities = 175/470 (37%), Positives = 241/470 (51%), Gaps = 9/470 (1%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+KY  L     ++   R++  +   +  MQ+F+G+ +TGK D  T+  MK+PRCG
Sbjct: 168 VQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCG 347

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD  +           + LT    +W+  H+ Y I+N TP +  A+   AI +AF +W 
Sbjct: 348 VPDVAQ-----------FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWS 494

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 495 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 653

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L  VA HELGH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 654 HFDEDERWT---NNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF--SGDVQLAQ 818

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  RS  P                          
Sbjct: 819 DDIDGIQAIYG------------------RSQNPVQPIGPQT------------------ 890

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAV 397
            P  CD    F+ +  +R E+  FKD+++  +R N       +  I+ FW  LP  ++A 
Sbjct: 891 -PKACDSKLTFDAITTIRGEVMFFKDRFY--MRTNPFYPEVELNFISVFWPQLPNGLEAA 1061

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTY 454
           YE ++ + V FFK NK+W  +   +  GYP D+ +   G P     ID+A+  E+ GKTY
Sbjct: 1062YEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS-SFGFPRTVKHIDAALSEENTGKTY 1238

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           FF  ++YWRY E  RSMDPGYPK I   + GI       F+  ++GF YF
Sbjct: 1239FFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFM--KDGFFYF 1382
>ref|NM_002421.2| Homo sapiens matrix metalloproteinase 1 (interstitial collagenase)
           (MMP1), mRNA
          Length = 1973

 Score =  272 bits (696), Expect = 6e-71
 Identities = 175/470 (37%), Positives = 241/470 (51%), Gaps = 9/470 (1%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+KY  L     ++   R++  +   +  MQ+F+G+ +TGK D  T+  MK+PRCG
Sbjct: 171 VQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCG 350

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD  +           + LT    +W+  H+ Y I+N TP +  A+   AI +AF +W 
Sbjct: 351 VPDVAQ-----------FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWS 497

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 498 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 656

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L  VA HELGH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 657 HFDEDERWT---NNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF--SGDVQLAQ 821

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  RS  P                          
Sbjct: 822 DDIDGIQAIYG------------------RSQNPVQPIGPQT------------------ 893

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAV 397
            P  CD    F+ +  +R E+  FKD+++  +R N       +  I+ FW  LP  ++A 
Sbjct: 894 -PKACDSKLTFDAITTIRGEVMFFKDRFY--MRTNPFYPEVELNFISVFWPQLPNGLEAA 1064

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTY 454
           YE ++ + V FFK NK+W  +   +  GYP D+ +   G P     ID+A+  E+ GKTY
Sbjct: 1065YEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS-SFGFPRTVKHIDAALSEENTGKTY 1241

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           FF  ++YWRY E  RSMDPGYPK I   + GI       F+  ++GF YF
Sbjct: 1242FFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFM--KDGFFYF 1385
>dbj|AK024818.1|AK024818 Homo sapiens cDNA: FLJ21165 fis, clone CAS10833, highly similar to
           HSCOLL1 Homo sapiens mRNA for type I interstitial
           collagenase
          Length = 1988

 Score =  272 bits (696), Expect = 6e-71
 Identities = 175/470 (37%), Positives = 241/470 (51%), Gaps = 9/470 (1%)
 Frame = +1

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+KY  L     ++   R++  +   +  MQ+F+G+ +TGK D  T+  MK+PRCG
Sbjct: 166 VQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCG 345

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD  +           + LT    +W+  H+ Y I+N TP +  A+   AI +AF +W 
Sbjct: 346 VPDVAQ-----------FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWS 492

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 493 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 651

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L  VA HELGH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 652 HFDEDERWT---NNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF--SGDVQLAQ 816

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  RS  P                          
Sbjct: 817 DDIDGIQAIYG------------------RSQNPVQPIGPQT------------------ 888

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAV 397
            P  CD    F+ +  +R E+  FKD+++  +R N       +  I+ FW  LP  ++A 
Sbjct: 889 -PKACDSKLTFDAITTIRGEVMFFKDRFY--MRTNPFYPEVELNFISVFWPQLPNGLEAA 1059

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTY 454
           YE ++ + V FFK NK+W  +   +  GYP D+ +   G P     ID+A+  E+ GKTY
Sbjct: 1060YEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS-SFGFPRTVKHIDAALSEENTGKTY 1236

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           FF  ++YWRY E  RSMDPGYPK I   + GI       F+  ++GF YF
Sbjct: 1237FFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFM--KDGFFYF 1380
>gb|BC013875.1|BC013875 Homo sapiens, Similar to matrix metalloproteinase 1 (interstitial
           collagenase), clone MGC:10479 IMAGE:3834572, mRNA,
           complete cds
          Length = 2057

 Score =  272 bits (696), Expect = 6e-71
 Identities = 175/470 (37%), Positives = 241/470 (51%), Gaps = 9/470 (1%)
 Frame = +1

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+KY  L     ++   R++  +   +  MQ+F+G+ +TGK D  T+  MK+PRCG
Sbjct: 151 VQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCG 330

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD  +           + LT    +W+  H+ Y I+N TP +  A+   AI +AF +W 
Sbjct: 331 VPDVAQ-----------FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWS 477

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 478 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 636

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L  VA HELGH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 637 HFDEDERWT---NNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF--SGDVQLAQ 801

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  RS  P                          
Sbjct: 802 DDIDGIQAIYG------------------RSQNPVQPIGPQT------------------ 873

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAV 397
            P  CD    F+ +  +R E+  FKD+++  +R N       +  I+ FW  LP  ++A 
Sbjct: 874 -PKACDSKLTFDAITTIRGEVMFFKDRFY--MRTNPFYPEVELNFISVFWPQLPNGLEAA 1044

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTY 454
           YE ++ + V FFK NK+W  +   +  GYP D+ +   G P     ID+A+  E+ GKTY
Sbjct: 1045YEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS-SFGFPRTVKHIDAALSEENTGKTY 1221

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           FF  ++YWRY E  RSMDPGYPK I   + GI       F+  ++GF YF
Sbjct: 1222FFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFM--KDGFFYF 1365
>gb|M25664.1|RABSTROM Rabbit metalloproteinase synovial cell activator mRNA, complete cds
          Length = 1795

 Score =  271 bits (693), Expect = 1e-70
 Identities = 169/471 (35%), Positives = 238/471 (49%), Gaps = 5/471 (1%)
 Frame = +1

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           ++ +L+ Y  L     +    + +  +   I  MQ+F G+ +TGK+D NT++ ++KPRCG
Sbjct: 154 LQQYLENYYNLEKDVKQFVKRKDSSPVVKKIQEMQKFLGLEVTGKLDSNTLEVIRKPRCG 333

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPD    S+              KW   H+ Y I N TP +       AI +A  VW+ V
Sbjct: 334 VPDVGHFSTFPGT---------PKWTKTHLTYRIVNYTPDLPRDAVDAAIEKALKVWEEV 486

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPLTF           + + DI I F    HGD  PFDG G  LAHAY PGPGI GD HF
Sbjct: 487 TPLTFSR-------KYEGEADIMISFGVREHGDFIPFDGPGNVLAHAYAPGPGINGDAHF 645

Query: 223 DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ-YMETDNFKLPND 281
           D DE WT    +  G +LFLVA HELGH+LGL HS +P A+M P Y  + +   F+L  D
Sbjct: 646 DDDEQWT---KDTTGTNLFLVAAHELGHSLGLFHSANPEALMYPVYNAFTDLARFRLSQD 816

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ +YG                    +PP                           
Sbjct: 817 DVDGIQSLYGPAPASPDNSGVPM-----EPVPPG-----------------------SGT 912

Query: 342 PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P +CD   +F+ +  LR E+  FKD++FWR ++ R+++     I+ FW  LP ++DA YE
Sbjct: 913 PVMCDPDLSFDAISTLRGEILFFKDRYFWR-KSLRILEPEFHLISSFWPSLPSAVDAAYE 1089

Query: 400 NSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
               + VF FK  +FW  +   +Q GYP  + TLG       ID+AI  ++  KTYFF  
Sbjct: 1090VISRDTVFIFKGTQFWAIRGNEVQAGYPRSIHTLGFPSTIRKIDAAISDKERKKTYFFVE 1269

Query: 459 DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKS 508
           D+YWR+ E+ +S++PG+P+ I   + GI  +P+   V +  GF YF    S
Sbjct: 1270DKYWRFDEKRQSLEPGFPRHIAEDFPGI--NPKIDAVFEAFGFFYFFSGSS 1416
 Score = 54.3 bits (129), Expect = 3e-05
 Identities = 46/151 (30%), Positives = 71/151 (46%), Gaps = 5/151 (3%)
 Frame = +1

Query: 393  SIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGK 452
            S DA+     G  +FFK   FW      L+P + H + +    +PS  +D+A        
Sbjct: 937  SFDAI-STLRGEILFFKDRYFWRKSLRILEPEF-HLISSFWPSLPS-AVDAAYEVISRDT 1107

Query: 453  TYFFKGDRYWRY-GEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEK 507
             + FKG ++W   G E+++   GYP+ I    G P + +    A   KE   TYF +++K
Sbjct: 1108 VFIFKGTQFWAIRGNEVQA---GYPRSIHTL-GFPSTIRKIDAAISDKERKKTYFFVEDK 1275

Query: 508  STGNSTKMLRVEPGYPRSILKDFMGCDGPTD 538
                  K   +EPG+PR I +DF G +   D
Sbjct: 1276 YWRFDEKRQSLEPGFPRHIAEDFPGINPKID 1368
>emb|X54724.1|SSMMP1 Porcine mmp1 mRNA for matrix metalloproteinase (type I collagenase)
           (EC 3.4.24.7)
          Length = 1336

 Score =  271 bits (693), Expect = 1e-70
 Identities = 173/469 (36%), Positives = 238/469 (49%), Gaps = 8/469 (1%)
 Frame = +2

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+ Y  L      +   R++  +   +  MQQF+G+ +TGK D  T++ MK+PRCG
Sbjct: 29  VQKYLKNYYNLNSDGVPVEKKRNSGLVVEKLKQMQQFFGLKVTGKPDAETLNVMKQPRCG 208

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD              + LT    +W++ H+ Y I+N TP +   +  +AI +AF +W 
Sbjct: 209 VPDVAE-----------FVLTPGNPRWENTHLTYRIENYTPDLSREDVDRAIEKAFQLWS 355

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NV+PLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 356 NVSPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 514

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L+ VA HELGH+LGL HS D  A+M P Y Y  T + +L  
Sbjct: 515 HFDEDERWT---KNFRDYNLYRVAAHELGHSLGLSHSTDIGALMYPNYIY--TGDVQLSQ 679

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                    + P+                         
Sbjct: 680 DDIDGIQAIYG---------------PSENPVQPSGPQT--------------------- 751

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
            P +CD    F+ +  LR E+  FKD+++ R  N+   +     I+ FW  +P  + A Y
Sbjct: 752 -PQVCDSKLTFDAITTLRGELMFFKDRFYMRT-NSFYPEVELNFISVFWPQVPNGLQAAY 925

Query: 399 ENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTYF 455
           E ++ + V FFK NK+W  +   +  GYP D I    G PS    ID+A++ ED GKTYF
Sbjct: 926 EIADRDEVRFFKGNKYWAVRGQDVLYGYPKD-IHRSFGFPSTVKNIDAAVFEEDTGKTYF 1102

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           F     WRY E  +SMD GYPK I   + GI       F  +++GF YF
Sbjct: 1103FVAHECWRYDEYKQSMDTGYPKMIAEEFPGIGNKVDAVF--QKDGFLYF 1243
>gb|M60616.1|RATCOL Rat collagenase (UMRCase) mRNA, 3' end
          Length = 2607

 Score =  271 bits (692), Expect = 2e-70
 Identities = 170/489 (34%), Positives = 244/489 (49%), Gaps = 12/489 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+ Y Y P T   +    +  +    +  MQ F+G+++TGK+D  T+D M+KPRCGV
Sbjct: 104 EHYLKSY-YHPVTLAGILKKSTVTSTVDRLREMQSFFGLDVTGKLDDPTLDIMRKPRCGV 280

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD       +N+  +       KW   ++ Y I N TP +  +E  KA R+AF VW +VT
Sbjct: 281 PDV----GVYNVFPRTL-----KWSQTNLTYRIVNYTPDISHSEVEKAFRKAFKVWSDVT 433

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F  +      +G    DI I F +  HGD  PFDG  G LAHA+ PGP +GGD HFD
Sbjct: 434 PLNFTRI-----HDGT--ADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNLGGDAHFD 592

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT  +    G +LF+VA HELGH+LGL+HS DP A+M P Y Y    +F LP+DD+
Sbjct: 593 DDETWTSSSK---GYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV 763

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-- 341
           QGIQ +YG                                              P  K  
Sbjct: 764 QGIQSLYGPGDED-----------------------------------------PNPKHP 820

Query: 342 --PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P  CD   + + +  LR E  +FKD++FWR+   +V +        FW  LP  +DA 
Sbjct: 821 KTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQV-EPELFLTKSFWPELPNHVDAA 997

Query: 398 YENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+   + +F F+  KFW      +  GYP  +  LG       + +A+ +ED GKT FF
Sbjct: 998 YEHPSRDLMFIFRGRKFWALNGYDIMEGYPRKISDLGFPKEVKRLSAAVHFEDTGKTLFF 1177

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----IKEKSTGN 511
            G+  W Y +  ++MD  YP+ I   + GI +      V+++NG+ YF    I+ + +  
Sbjct: 1178SGNHVWSYDDANQTMDKDYPRLIEEEFPGIGDKVDA--VYEKNGYIYFFNGPIQFEYSIW 1351

Query: 512 STKMLRVEP 520
           S +++RV P
Sbjct: 1352SNRIVRVMP 1378
>gb|AE003464.1|AE003464 Drosophila melanogaster genomic scaffold 142000013386038 section 13 of
              15, complete sequence
          Length = 306848

 Score =  204 bits (518), Expect(2) = 3e-70
 Identities = 117/325 (36%), Positives = 164/325 (50%), Gaps = 1/325 (0%)
 Frame = -2

Query: 182    VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
              + +T  F    HGD   FDG+GG LAHA+FP    GGD HFD  E WT+G+P   G +LF
Sbjct: 298822 LSLTPRFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAHFDDAELWTIGSPR--GTNLF 298655

Query: 242    LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
               VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  DD   IQ +YG          
Sbjct: 298654 QVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPV-FKLDEDDKAAIQSLYGRKTNQLRPTN 298478

Query: 302    XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFV 361
                         PP                          K +  D  FN+    + E + 
Sbjct: 298477 VYPATTQRPYSPPKVPLDDSI-----------------CKDSKVDTLFNSA---QGETYA 298358

Query: 362    FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTL 421
              FK   ++++  + V +GYP  I+  W GLP +IDA +    G   FFK  ++W ++   +
Sbjct: 298357 FKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYKNGKTYFFKGTQYWRYQGRQM 298178

Query: 422    QPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRS-MDPGYPKPIT 480
                 YP ++    +GIP H +D+A+ W   GK YFFKG ++WR+    R  +   YPKPI+
Sbjct: 298177 DGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYPKPIS 298001

Query: 481    IWKGIPESPQGAFVHKENGFTYFIK 505
               W+G+P +   A  +  NG+TYF K
Sbjct: 298000 NWEGVPNNLDAALKY-TNGYTYFFK 297929
 Score = 88.6 bits (218), Expect(2) = 3e-70
 Identities = 50/127 (39%), Positives = 70/127 (54%), Gaps = 3/127 (2%)
 Frame = -1

Query: 44     EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
              +++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 299282 QIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 299103

Query: 102    GVPDQT-RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
              GV D+   G S    R KRYAL G +W+ K++ Y I     ++   +    I RAF VW 
Sbjct: 299102 GVRDRVGTGDS----RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWS 298935

Query: 161    NVTPLTF 167
                T LTF
Sbjct: 298934 EDTDLTF 298914
 Score = 74.7 bits (182), Expect = 2e-11
 Identities = 47/136 (34%), Positives = 74/136 (53%), Gaps = 3/136 (2%)
 Frame = -2

Query: 394    IDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
              +D ++ +++G    FK +K++     +++ GYP  +     G+P + ID+A  +++ GKT
Sbjct: 298399 VDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGN-IDAAFTYKN-GKT 298226

Query: 454    YFFKGDRYWRYGEEMRSMDPGYPKPITI-WKGIPESPQGAFVHKENGFTYFIKEKS--TG 510
              YFFKG +YWRY  + R MD  YPK I+  + GIP+    A V   NG  YF K       
Sbjct: 298225 YFFKGTQYWRY--QGRQMDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRF 298052

Query: 511    NSTKMLRVEPGYPRSI 526
              +  K   V+  YP+ I
Sbjct: 298051 DPAKRPPVKASYPKPI 298004
 Score = 40.4 bits (93), Expect = 0.51
 Identities = 21/64 (32%), Positives = 34/64 (52%), Gaps = 3/64 (4%)
 Frame = -2

Query: 358    EMFVFKDQWFWR---VRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFW 414
              +++ FK   FWR    +   V   YP  I+  W G+P ++DA  + + G   FFK +K++
Sbjct: 298090 KIYFFKGSKFWRFDPAKRPPVKASYPKPISN-WEGVPNNLDAALKYTNGYTYFFKGDKYY 297914

Query: 415    VFKD 418
               F D
Sbjct: 297913 RFHD 297902
>gb|AC099037.1| Drosophila melanogaster, chromosome 2R, region 60E-60F, BAC clone
              BACR27P17, complete sequence
          Length = 193322

 Score =  204 bits (518), Expect(2) = 3e-70
 Identities = 117/325 (36%), Positives = 164/325 (50%), Gaps = 1/325 (0%)
 Frame = +2

Query: 182    VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
              + +T  F    HGD   FDG+GG LAHA+FP    GGD HFD  E WT+G+P   G +LF
Sbjct: 181427 LSLTPRFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAHFDDAELWTIGSPR--GTNLF 181594

Query: 242    LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
               VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  DD   IQ +YG          
Sbjct: 181595 QVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPV-FKLDEDDKAAIQSLYGRKTNQLRPTN 181771

Query: 302    XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFV 361
                         PP                          K +  D  FN+    + E + 
Sbjct: 181772 VYPATTQRPYSPPKVPLDDSI-----------------CKDSKVDTLFNSA---QGETYA 181891

Query: 362    FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTL 421
              FK   ++++  + V +GYP  I+  W GLP +IDA +    G   FFK  ++W ++   +
Sbjct: 181892 FKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYKNGKTYFFKGTQYWRYQGRQM 182071

Query: 422    QPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMR-SMDPGYPKPIT 480
                 YP ++    +GIP H +D+A+ W   GK YFFKG ++WR+    R  +   YPKPI+
Sbjct: 182072 DGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYPKPIS 182248

Query: 481    IWKGIPESPQGAFVHKENGFTYFIK 505
               W+G+P +   A  +  NG+TYF K
Sbjct: 182249 NWEGVPNNLDAALKY-TNGYTYFFK 182320
 Score = 88.6 bits (218), Expect(2) = 3e-70
 Identities = 50/127 (39%), Positives = 70/127 (54%), Gaps = 3/127 (2%)
 Frame = +1

Query: 44     EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
              +++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 180967 QIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 181146

Query: 102    GVPDQT-RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
              GV D+   G S    R KRYAL G +W+ K++ Y I     ++   +    I RAF VW 
Sbjct: 181147 GVRDRVGTGDS----RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWS 181314

Query: 161    NVTPLTF 167
                T LTF
Sbjct: 181315 EDTDLTF 181335
 Score = 74.7 bits (182), Expect = 2e-11
 Identities = 47/136 (34%), Positives = 74/136 (53%), Gaps = 3/136 (2%)
 Frame = +2

Query: 394    IDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
              +D ++ +++G    FK +K++     +++ GYP  +     G+P + ID+A  +++ GKT
Sbjct: 181850 VDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGN-IDAAFTYKN-GKT 182023

Query: 454    YFFKGDRYWRYGEEMRSMDPGYPKPITI-WKGIPESPQGAFVHKENGFTYFIKEKS--TG 510
              YFFKG +YWRY  + R MD  YPK I+  + GIP+    A V   NG  YF K       
Sbjct: 182024 YFFKGTQYWRY--QGRQMDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRF 182197

Query: 511    NSTKMLRVEPGYPRSI 526
              +  K   V+  YP+ I
Sbjct: 182198 DPAKRPPVKASYPKPI 182245
 Score = 40.4 bits (93), Expect = 0.51
 Identities = 21/64 (32%), Positives = 34/64 (52%), Gaps = 3/64 (4%)
 Frame = +2

Query: 358    EMFVFKDQWFWR---VRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFW 414
              +++ FK   FWR    +   V   YP  I+  W G+P ++DA  + + G   FFK +K++
Sbjct: 182159 KIYFFKGSKFWRFDPAKRPPVKASYPKPISN-WEGVPNNLDAALKYTNGYTYFFKGDKYY 182335

Query: 415    VFKD 418
               F D
Sbjct: 182336 RFHD 182347
>gb|AC007925.5|AC007925 Drosophila melanogaster, chromosome 2R, region 60E-60E, BAC clone
             BACR03B07, complete sequence
          Length = 170089

 Score =  204 bits (518), Expect(2) = 3e-70
 Identities = 117/325 (36%), Positives = 164/325 (50%), Gaps = 1/325 (0%)
 Frame = -3

Query: 182   VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
             + +T  F    HGD   FDG+GG LAHA+FP    GGD HFD  E WT+G+P   G +LF
Sbjct: 26585 LSLTPRFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAHFDDAELWTIGSPR--GTNLF 26418

Query: 242   LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
              VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  DD   IQ +YG          
Sbjct: 26417 QVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPV-FKLDEDDKAAIQSLYGRKTNQLRPTN 26241

Query: 302   XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFV 361
                        PP                          K +  D  FN+    + E + 
Sbjct: 26240 VYPATTQRPYSPPKVPLDDSI-----------------CKDSKVDTLFNSA---QGETYA 26121

Query: 362   FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTL 421
             FK   ++++  + V +GYP  I+  W GLP +IDA +    G   FFK  ++W ++   +
Sbjct: 26120 FKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYKNGKTYFFKGTQYWRYQGRQM 25941

Query: 422   QPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRS-MDPGYPKPIT 480
                YP ++    +GIP H +D+A+ W   GK YFFKG ++WR+    R  +   YPKPI+
Sbjct: 25940 DGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYPKPIS 25764

Query: 481   IWKGIPESPQGAFVHKENGFTYFIK 505
              W+G+P +   A  +  NG+TYF K
Sbjct: 25763 NWEGVPNNLDAALKY-TNGYTYFFK 25692
 Score = 88.6 bits (218), Expect(2) = 3e-70
 Identities = 50/127 (39%), Positives = 70/127 (54%), Gaps = 3/127 (2%)
 Frame = -2

Query: 44    EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
             +++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 27045 QIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 26866

Query: 102   GVPDQT-RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
             GV D+   G S    R KRYAL G +W+ K++ Y I     ++   +    I RAF VW 
Sbjct: 26865 GVRDRVGTGDS----RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWS 26698

Query: 161   NVTPLTF 167
               T LTF
Sbjct: 26697 EDTDLTF 26677
 Score = 74.7 bits (182), Expect = 2e-11
 Identities = 47/136 (34%), Positives = 74/136 (53%), Gaps = 3/136 (2%)
 Frame = -3

Query: 394   IDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
             +D ++ +++G    FK +K++     +++ GYP  +     G+P + ID+A  +++ GKT
Sbjct: 26162 VDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGN-IDAAFTYKN-GKT 25989

Query: 454   YFFKGDRYWRYGEEMRSMDPGYPKPITI-WKGIPESPQGAFVHKENGFTYFIKEKS--TG 510
             YFFKG +YWRY  + R MD  YPK I+  + GIP+    A V   NG  YF K       
Sbjct: 25988 YFFKGTQYWRY--QGRQMDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRF 25815

Query: 511   NSTKMLRVEPGYPRSI 526
             +  K   V+  YP+ I
Sbjct: 25814 DPAKRPPVKASYPKPI 25767
 Score = 40.4 bits (93), Expect = 0.51
 Identities = 21/64 (32%), Positives = 34/64 (52%), Gaps = 3/64 (4%)
 Frame = -3

Query: 358   EMFVFKDQWFWR---VRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFW 414
             +++ FK   FWR    +   V   YP  I+  W G+P ++DA  + + G   FFK +K++
Sbjct: 25853 KIYFFKGSKFWRFDPAKRPPVKASYPKPISN-WEGVPNNLDAALKYTNGYTYFFKGDKYY 25677

Query: 415   VFKD 418
              F D
Sbjct: 25676 RFHD 25665
>gb|AC007581.5|AC007581 Drosophila melanogaster, chromosome 2R, region 60E-60E, BAC clone
              BACR03I24, complete sequence
          Length = 156508

 Score =  204 bits (518), Expect(2) = 3e-70
 Identities = 117/325 (36%), Positives = 164/325 (50%), Gaps = 1/325 (0%)
 Frame = -3

Query: 182    VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
              + +T  F    HGD   FDG+GG LAHA+FP    GGD HFD  E WT+G+P   G +LF
Sbjct: 104534 LSLTPRFVESEHGDGDAFDGQGGTLAHAFFPV--FGGDAHFDDAELWTIGSPR--GTNLF 104367

Query: 242    LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
               VA HE GH+LGL HS+  +A+MAPFY+  E   FKL  DD   IQ +YG          
Sbjct: 104366 QVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPV-FKLDEDDKAAIQSLYGRKTNQLRPTN 104190

Query: 302    XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFV 361
                         PP                          K +  D  FN+    + E + 
Sbjct: 104189 VYPATTQRPYSPPKVPLDDSI-----------------CKDSKVDTLFNSA---QGETYA 104070

Query: 362    FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTL 421
              FK   ++++  + V +GYP  I+  W GLP +IDA +    G   FFK  ++W ++   +
Sbjct: 104069 FKGDKYYKLTTDSVEEGYPQLISKGWPGLPGNIDAAFTYKNGKTYFFKGTQYWRYQGRQM 103890

Query: 422    QPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMR-SMDPGYPKPIT 480
                 YP ++    +GIP H +D+A+ W   GK YFFKG ++WR+    R  +   YPKPI+
Sbjct: 103889 DGVYPKEISEGFTGIPDH-LDAAMVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYPKPIS 103713

Query: 481    IWKGIPESPQGAFVHKENGFTYFIK 505
               W+G+P +   A  +  NG+TYF K
Sbjct: 103712 NWEGVPNNLDAALKY-TNGYTYFFK 103641
 Score = 88.6 bits (218), Expect(2) = 3e-70
 Identities = 50/127 (39%), Positives = 70/127 (54%), Gaps = 3/127 (2%)
 Frame = -2

Query: 44     EVWLQKYGYLPPT--DPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
              +++L ++GYLP +  +P  S L    T  SAI   Q F G+N+TG++D  T+  M  PRC
Sbjct: 104994 QIYLSQFGYLPASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRC 104815

Query: 102    GVPDQT-RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
              GV D+   G S    R KRYAL G +W+ K++ Y I     ++   +    I RAF VW 
Sbjct: 104814 GVRDRVGTGDS----RSKRYALQGSRWRVKNLTYKISKYPKRLKRVDVDAEIGRAFAVWS 104647

Query: 161    NVTPLTF 167
                T LTF
Sbjct: 104646 EDTDLTF 104626
 Score = 74.7 bits (182), Expect = 2e-11
 Identities = 47/136 (34%), Positives = 74/136 (53%), Gaps = 3/136 (2%)
 Frame = -3

Query: 394    IDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
              +D ++ +++G    FK +K++     +++ GYP  +     G+P + ID+A  +++ GKT
Sbjct: 104111 VDTLFNSAQGETYAFKGDKYYKLTTDSVEEGYPQLISKGWPGLPGN-IDAAFTYKN-GKT 103938

Query: 454    YFFKGDRYWRYGEEMRSMDPGYPKPITI-WKGIPESPQGAFVHKENGFTYFIKEKS--TG 510
              YFFKG +YWRY  + R MD  YPK I+  + GIP+    A V   NG  YF K       
Sbjct: 103937 YFFKGTQYWRY--QGRQMDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRF 103764

Query: 511    NSTKMLRVEPGYPRSI 526
              +  K   V+  YP+ I
Sbjct: 103763 DPAKRPPVKASYPKPI 103716
 Score = 40.4 bits (93), Expect = 0.51
 Identities = 21/64 (32%), Positives = 34/64 (52%), Gaps = 3/64 (4%)
 Frame = -3

Query: 358    EMFVFKDQWFWR---VRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFW 414
              +++ FK   FWR    +   V   YP  I+  W G+P ++DA  + + G   FFK +K++
Sbjct: 103802 KIYFFKGSKFWRFDPAKRPPVKASYPKPISN-WEGVPNNLDAALKYTNGYTYFFKGDKYY 103626

Query: 415    VFKD 418
               F D
Sbjct: 103625 RFHD 103614
>emb|X05231.1|HSCOLLR Human mRNA for collagenase (E.C. 3.4.24)
          Length = 1968

 Score =  270 bits (690), Expect = 3e-70
 Identities = 174/470 (37%), Positives = 239/470 (50%), Gaps = 9/470 (1%)
 Frame = +1

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+KY  L     ++   R++  +   +  MQ+F+G+ +TGK D  T+  MK+PRCG
Sbjct: 166 VQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCG 345

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD  +           + LT    +W+  H+ Y I+N TP +  A+   AI +AF +W 
Sbjct: 346 VPDVAQ-----------FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWS 492

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 493 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 651

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD  E WT    N    +L  VA HELGH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 652 HFDEHERWT---NNFTEYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF--SGDVQLAQ 816

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  RS  P                          
Sbjct: 817 DDIDGIQAIYG------------------RSQNPVQPIGPQT------------------ 888

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQIT-YFWRGLPPSIDAV 397
            P  CD    F+ +  +R E+  FKD+++  +R N       +  T  FW  LP  ++A 
Sbjct: 889 -PKACDSKLTFDAITTIRGEVMFFKDRFY--MRTNPFYPEVELNFTSVFWPQLPNGLEAA 1059

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTY 454
           YE ++ + V FFK NK+W  +   +  GYP D+ +   G P     ID+A+  E+ GKTY
Sbjct: 1060YEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS-SFGFPRTVKHIDAALSEENTGKTY 1236

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           FF  ++YWRY E  RSMDPGYPK I   + GI       F+  ++GF YF
Sbjct: 1237FFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFM--KDGFFYF 1380
>gb|M13509.1|HUMCN2 Human skin collagenase mRNA, complete cds
          Length = 1970

 Score =  270 bits (689), Expect = 4e-70
 Identities = 174/470 (37%), Positives = 240/470 (51%), Gaps = 9/470 (1%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+KY  L     ++   R++  +   +  MQ+F+G+ +TGK D  T+  MK+PRCG
Sbjct: 168 VQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCG 347

Query: 103 VPDQTRGSSKFNIRRKRYALT--GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD  +           + LT    +W+  H+ Y I+N TP +  A+   AI +AF +W 
Sbjct: 348 VPDVAQ-----------FVLTEGNPRWEQTHLRYRIENYTPDLPRADVDHAIEKAFQLWS 494

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PGPGIGGD 
Sbjct: 495 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDA 653

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L  VA HELGH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 654 HFDEDERWT---NNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF--SGDVQLAQ 818

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  RS  P                          
Sbjct: 819 DDIDGIQAIYG------------------RSQNPVQPIGPQT------------------ 890

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAV 397
            P  CD    F+ +  +R E+  FKD+++  +R N       +  I+ FW  LP  ++A 
Sbjct: 891 -PKACDSKLTFDAITTIRGEVMFFKDRFY--MRTNPFYPEVELNFISVFWPQLPNGLEAA 1061

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTY 454
           YE ++ + V FFK NK+W  +   +  GYP D+ +   G P     ID+A+  E+ GKTY
Sbjct: 1062YEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS-SFGFPRTVKHIDAALSEENTGKTY 1238

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           FF  ++YWRY E  RSMDP YPK I   + GI       F+  ++GF YF
Sbjct: 1239FFVANKYWRYDEYKRSMDPSYPKMIAHDFPGIGHKVDAVFM--KDGFFYF 1382
>gb|BC006725.1|BC006725 Mus musculus, matrix metalloproteinase 3, clone MGC:11554
           IMAGE:3962288, mRNA, complete cds
          Length = 1783

 Score =  268 bits (686), Expect = 9e-70
 Identities = 179/502 (35%), Positives = 240/502 (47%), Gaps = 16/502 (3%)
 Frame = +2

Query: 23  LQTCVWILCATVCKAEQYFN-----------VEVWLQKYGYLPPTDPRMSVLRSAETMQS 71
           L   +W LC  VC +    +           ++ +L+ Y  L     +    + +  +  
Sbjct: 56  LPVLLW-LCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSSLIVK 232

Query: 72  AIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKH 131
            I  MQ+F G+ MTGK+D NT++ M KPRCGVPD   G S F            KW+  H
Sbjct: 233 KIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD-VGGFSTFP--------GSPKWRKSH 385

Query: 132 IAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASG 191
           I Y I N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA G
Sbjct: 386 ITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRI-------SEGEADIMISFAVG 544

Query: 192 FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHA 251
            HGD  PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HELGH+
Sbjct: 545 EHGDFVPFDGPGTVLAHAYAPGPGINGDAHFDDDERWT---EDVTGTNLFLVAAHELGHS 715

Query: 252 LGLEHSNDPTAIMAPFYQ-YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR 310
           LGL HS    A+M P Y+   +   F L  DD+ GIQ +YG                   
Sbjct: 716 LGLYHSAKAEALMYPVYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLV--------- 868

Query: 311 SIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFW 368
            +P                        P   P +C     F+ +  LR E+  FKD+ FW
Sbjct: 869 -VPTKSNSLE-----------------PETSP-MCSSTLFFDAVSTLRGEVLFFKDRHFW 991

Query: 369 RVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPH 427
           R ++ R  +     I+ FW  LP ++DA YE +  + VF FK N+FW  +      GYP 
Sbjct: 992 R-KSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGNQFWAIRGHEELAGYPK 1168

Query: 428 DLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIP 486
            + TLG       ID+AI  ++  KTYFF  D+YWR+ E+ +SM+PG+P+ I   + G+ 
Sbjct: 1169SIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVD 1348

Query: 487 ESPQGAFVHKENGFTYFIKEKS 508
                 F  +  GF YF    S
Sbjct: 1349SRVDAVF--EAFGFLYFFSGSS 1408
 Score = 56.6 bits (135), Expect = 7e-06
 Identities = 45/142 (31%), Positives = 71/142 (49%), Gaps = 6/142 (4%)
 Frame = +2

Query: 403  GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
            G  +FFK   FW     T +P + + + +    +PS+ +D+A    +    + FKG+++W
Sbjct: 956  GEVLFFKDRHFWRKSLRTPEPEF-YLISSFWPSLPSN-MDAAYEVTNRDTVFIFKGNQFW 1129

Query: 463  --RYGEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEKSTGNSTKML 516
              R  EE+     GYPK I    G+P + +    A  +KE   TYF +++K      K  
Sbjct: 1130 AIRGHEELA----GYPKSIHTL-GLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQ 1294

Query: 517  RVEPGYPRSILKDFMGCDGPTD 538
             +EPG+PR I +DF G D   D
Sbjct: 1295 SMEPGFPRKIAEDFPGVDSRVD 1360
>gb|L76275.1|XELCOLL Xenopus laevis collagenase 4 precursor gene, complete cds
          Length = 1609

 Score =  268 bits (686), Expect = 9e-70
 Identities = 169/471 (35%), Positives = 238/471 (49%), Gaps = 10/471 (2%)
 Frame = +3

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+F+G+ +TG +D  T++ M+KPRCGV D  + S+               WQ K + Y 
Sbjct: 228 MQKFFGLKVTGTLDPKTVEVMEKPRCGVYDVGQYST---------VAKSSAWQKKDLTYR 380

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD 195
           I N TP +  A+   AI+RAF VW +VTPLTF  + Y E+       DI I F +G H D
Sbjct: 381 ILNFTPDLPQADVETAIQRAFKVWSDVTPLTFTRI-YNEVS------DIEISFTAGDHKD 539

Query: 196 SSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLE 255
           +SPFDG GG LAHA+ PG GIGGD HFD DE WT  +  +   +LFLVA HE GH+LGL 
Sbjct: 540 NSPFDGSGGILAHAFQPGNGIGGDAHFDEDETWTKTSEIY---NLFLVAAHEFGHSLGLS 710

Query: 256 HSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPA 315
           HS D  A+M P Y   +   F+LP DD+  IQ +YG                    + P 
Sbjct: 711 HSTDQGALMYPTYSNTDPKTFQLPQDDINAIQYLYGKSS---------------NPVQPT 845

Query: 316 XXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFWRVRNN 373
                                   + P+ CD N  FN +  +R E+  F  ++ WR ++ 
Sbjct: 846 G----------------------PSTPSRCDPNVVFNAVTTMRGELIFFVKRFLWR-KHP 956

Query: 374 RVMDGYPMQITYFWRGLPPSIDAVYENS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITL 432
           +  +   M +  FW  LP +IDA YEN      + FK +K+       +  GYP ++ +L
Sbjct: 957 QASEAELMFVQAFWPSLPTNIDAAYENPITEQILVFKGSKYTALDGFDVVQGYPRNIYSL 1136

Query: 433 GSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQG 491
           G       ID+A+  E +GKTYFF   +YW Y E+ + MD G+PK I+  + GIP+    
Sbjct: 1137GFPKTVKRIDAAVHIEQLGKTYFFAAKKYWSYDEDKKQMDKGFPKQISNDFPGIPDKIDA 1316

Query: 492 AFVHKENGFTYFIKEKS----TGNSTKMLRVEPGYPRSILKDFMGC--DGP 536
           AF ++  G  YF   +S      NS ++++V           ++GC  DGP
Sbjct: 1317AFYYR--GRLYFFIGRSQFEYNINSKRIVQVLRS------NSWLGC**DGP 1445
>emb|X66402.1|MMSTLY M.musculus mRNA for stromelysin 1
          Length = 1740

 Score =  268 bits (686), Expect = 9e-70
 Identities = 179/502 (35%), Positives = 240/502 (47%), Gaps = 16/502 (3%)
 Frame = +1

Query: 23  LQTCVWILCATVCKAEQYFN-----------VEVWLQKYGYLPPTDPRMSVLRSAETMQS 71
           L   +W LC  VC +    +           ++ +L+ Y  L     +    + +  +  
Sbjct: 34  LPVLLW-LCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSSLIVK 210

Query: 72  AIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKH 131
            I  MQ+F G+ MTGK+D NT++ M KPRCGVPD   G S F            KW+  H
Sbjct: 211 KIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD-VGGFSTFP--------GSPKWRKSH 363

Query: 132 IAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASG 191
           I Y I N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA G
Sbjct: 364 ITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRI-------SEGEADIMISFAVG 522

Query: 192 FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHA 251
            HGD  PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HELGH+
Sbjct: 523 EHGDFVPFDGPGTVLAHAYAPGPGINGDAHFDDDERWT---EDVTGTNLFLVAAHELGHS 693

Query: 252 LGLEHSNDPTAIMAPFYQ-YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR 310
           LGL HS    A+M P Y+   +   F L  DD+ GIQ +YG                   
Sbjct: 694 LGLYHSAKAEALMYPVYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLV--------- 846

Query: 311 SIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFW 368
            +P                        P   P +C     F+ +  LR E+  FKD+ FW
Sbjct: 847 -VPTKSNSLE-----------------PETSP-MCSSTLFFDAVSTLRGEVLFFKDRHFW 969

Query: 369 RVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPH 427
           R ++ R  +     I+ FW  LP ++DA YE +  + VF FK N+FW  +      GYP 
Sbjct: 970 R-KSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGNQFWAIRGHEELAGYPK 1146

Query: 428 DLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIP 486
            + TLG       ID+AI  ++  KTYFF  D+YWR+ E+ +SM+PG+P+ I   + G+ 
Sbjct: 1147SIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVD 1326

Query: 487 ESPQGAFVHKENGFTYFIKEKS 508
                 F  +  GF YF    S
Sbjct: 1327SRVDAVF--EAFGFLYFFSGSS 1386
 Score = 56.6 bits (135), Expect = 7e-06
 Identities = 45/142 (31%), Positives = 71/142 (49%), Gaps = 6/142 (4%)
 Frame = +1

Query: 403  GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
            G  +FFK   FW     T +P + + + +    +PS+ +D+A    +    + FKG+++W
Sbjct: 934  GEVLFFKDRHFWRKSLRTPEPEF-YLISSFWPSLPSN-MDAAYEVTNRDTVFIFKGNQFW 1107

Query: 463  --RYGEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEKSTGNSTKML 516
              R  EE+     GYPK I    G+P + +    A  +KE   TYF +++K      K  
Sbjct: 1108 AIRGHEELA----GYPKSIHTL-GLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQ 1272

Query: 517  RVEPGYPRSILKDFMGCDGPTD 538
             +EPG+PR I +DF G D   D
Sbjct: 1273 SMEPGFPRKIAEDFPGVDSRVD 1338
>ref|NM_010809.1| Mus musculus matrix metalloproteinase 3 (Mmp3), mRNA
          Length = 1858

 Score =  268 bits (686), Expect = 9e-70
 Identities = 179/502 (35%), Positives = 240/502 (47%), Gaps = 16/502 (3%)
 Frame = +2

Query: 23  LQTCVWILCATVCKAEQYFN-----------VEVWLQKYGYLPPTDPRMSVLRSAETMQS 71
           L   +W LC  VC +    +           ++ +L+ Y  L     +    + +  +  
Sbjct: 92  LPVLLW-LCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSSLIVK 268

Query: 72  AIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKH 131
            I  MQ+F G+ MTGK+D NT++ M KPRCGVPD   G S F            KW+  H
Sbjct: 269 KIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD-VGGFSTFP--------GSPKWRKSH 421

Query: 132 IAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASG 191
           I Y I N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA G
Sbjct: 422 ITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRI-------SEGEADIMISFAVG 580

Query: 192 FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHA 251
            HGD  PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HELGH+
Sbjct: 581 EHGDFVPFDGPGTVLAHAYAPGPGINGDAHFDDDERWT---EDVTGTNLFLVAAHELGHS 751

Query: 252 LGLEHSNDPTAIMAPFYQ-YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR 310
           LGL HS    A+M P Y+   +   F L  DD+ GIQ +YG                   
Sbjct: 752 LGLYHSAKAEALMYPVYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLV--------- 904

Query: 311 SIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFW 368
            +P                        P   P +C     F+ +  LR E+  FKD+ FW
Sbjct: 905 -VPTKSNSLE-----------------PETSP-MCSSTLFFDAVSTLRGEVLFFKDRHFW 1027

Query: 369 RVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPH 427
           R ++ R  +     I+ FW  LP ++DA YE +  + VF FK N+FW  +      GYP 
Sbjct: 1028R-KSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGNQFWAIRGHEELAGYPK 1204

Query: 428 DLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIP 486
            + TLG       ID+AI  ++  KTYFF  D+YWR+ E+ +SM+PG+P+ I   + G+ 
Sbjct: 1205SIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVD 1384

Query: 487 ESPQGAFVHKENGFTYFIKEKS 508
                 F  +  GF YF    S
Sbjct: 1385SRVDAVF--EAFGFLYFFSGSS 1444
 Score = 56.6 bits (135), Expect = 7e-06
 Identities = 45/142 (31%), Positives = 71/142 (49%), Gaps = 6/142 (4%)
 Frame = +2

Query: 403  GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
            G  +FFK   FW     T +P + + + +    +PS+ +D+A    +    + FKG+++W
Sbjct: 992  GEVLFFKDRHFWRKSLRTPEPEF-YLISSFWPSLPSN-MDAAYEVTNRDTVFIFKGNQFW 1165

Query: 463  --RYGEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEKSTGNSTKML 516
              R  EE+     GYPK I    G+P + +    A  +KE   TYF +++K      K  
Sbjct: 1166 AIRGHEELA----GYPKSIHTL-GLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQ 1330

Query: 517  RVEPGYPRSILKDFMGCDGPTD 538
             +EPG+PR I +DF G D   D
Sbjct: 1331 SMEPGFPRKIAEDFPGVDSRVD 1396
>emb|X63162.1|MMTRANS1 M.musculus mRNA for transin-1
          Length = 1858

 Score =  268 bits (686), Expect = 9e-70
 Identities = 179/502 (35%), Positives = 240/502 (47%), Gaps = 16/502 (3%)
 Frame = +2

Query: 23  LQTCVWILCATVCKAEQYFN-----------VEVWLQKYGYLPPTDPRMSVLRSAETMQS 71
           L   +W LC  VC +    +           ++ +L+ Y  L     +    + +  +  
Sbjct: 92  LPVLLW-LCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSSLIVK 268

Query: 72  AIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKH 131
            I  MQ+F G+ MTGK+D NT++ M KPRCGVPD   G S F            KW+  H
Sbjct: 269 KIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPD-VGGFSTFP--------GSPKWRKSH 421

Query: 132 IAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASG 191
           I Y I N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA G
Sbjct: 422 ITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRI-------SEGEADIMISFAVG 580

Query: 192 FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHA 251
            HGD  PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA HELGH+
Sbjct: 581 EHGDFVPFDGPGTVLAHAYAPGPGINGDAHFDDDERWT---EDVTGTNLFLVAAHELGHS 751

Query: 252 LGLEHSNDPTAIMAPFYQ-YMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHR 310
           LGL HS    A+M P Y+   +   F L  DD+ GIQ +YG                   
Sbjct: 752 LGLYHSAKAEALMYPVYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLV--------- 904

Query: 311 SIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFW 368
            +P                        P   P +C     F+ +  LR E+  FKD+ FW
Sbjct: 905 -VPTKSNSLE-----------------PETSP-MCSSTLFFDAVSTLRGEVLFFKDRHFW 1027

Query: 369 RVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPH 427
           R ++ R  +     I+ FW  LP ++DA YE +  + VF FK N+FW  +      GYP 
Sbjct: 1028R-KSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGNQFWAIRGHEELAGYPK 1204

Query: 428 DLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIP 486
            + TLG       ID+AI  ++  KTYFF  D+YWR+ E+ +SM+PG+P+ I   + G+ 
Sbjct: 1205SIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVD 1384

Query: 487 ESPQGAFVHKENGFTYFIKEKS 508
                 F  +  GF YF    S
Sbjct: 1385SRVDAVF--EAFGFLYFFSGSS 1444
 Score = 56.6 bits (135), Expect = 7e-06
 Identities = 45/142 (31%), Positives = 71/142 (49%), Gaps = 6/142 (4%)
 Frame = +2

Query: 403  GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
            G  +FFK   FW     T +P + + + +    +PS+ +D+A    +    + FKG+++W
Sbjct: 992  GEVLFFKDRHFWRKSLRTPEPEF-YLISSFWPSLPSN-MDAAYEVTNRDTVFIFKGNQFW 1165

Query: 463  --RYGEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEKSTGNSTKML 516
              R  EE+     GYPK I    G+P + +    A  +KE   TYF +++K      K  
Sbjct: 1166 AIRGHEELA----GYPKSIHTL-GLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQ 1330

Query: 517  RVEPGYPRSILKDFMGCDGPTD 538
             +EPG+PR I +DF G D   D
Sbjct: 1331 SMEPGFPRKIAEDFPGVDSRVD 1396
>gb|AF072685.1|AF072685 Bos taurus matrix metalloproteinase 13 (MMP13) mRNA, complete cds
          Length = 1516

 Score =  268 bits (684), Expect = 2e-69
 Identities = 168/472 (35%), Positives = 234/472 (48%), Gaps = 6/472 (1%)
 Frame = +1

Query: 38  EQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMK 97
           E +   E +L+ Y Y P     +    +A ++   +  MQ F+G+ +TG++D NT+D MK
Sbjct: 100 EDFQFAESYLKSY-YYPQNPAGILKKTAASSVIDRLREMQSFFGLEVTGRLDDNTLDIMK 276

Query: 98  KPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFD 157
           KPRCGVPD      ++N+  +       KW   ++ Y I N TP +  +E  KA R+AF 
Sbjct: 277 KPRCGVPDV----GEYNVFPRTL-----KWSKMNLTYRIVNYTPDLTHSEVEKAFRKAFK 429

Query: 158 VWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG 217
           VW +VTPL F  +      NG    DI I F +  HGD  PFDG  G LAHA+ PGP  G
Sbjct: 430 VWSDVTPLNFTRI-----HNGT--ADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYG 588

Query: 218 GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFK 277
           GD HFD DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y    +F 
Sbjct: 589 GDAHFDDDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFM 759

Query: 278 LPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSY 337
           LP+DD+QGIQ +YG                                            S 
Sbjct: 760 LPDDDVQGIQSLYG-------------------------------------PGDEDPYSK 828

Query: 338 PGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID 395
               P+ CD   + + +  LR E  +FKD++FWR+   +V +        F   LP  ID
Sbjct: 829 HPKTPDKCDPSLSLDAITSLRGETLIFKDRFFWRLHPQQV-EAELFLTKSFGPELPNRID 1005

Query: 396 AVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSH--GIDSAIWWEDVGK 452
           A YE+   + +F F+  KFW      +   YP  +  L  G P H   I +A+ +ED GK
Sbjct: 1006AAYEHPSHDLIFIFRGRKFWALSGYDILEDYPKKISEL--GFPKHVKKISAALHFEDSGK 1179

Query: 453 TYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF 503
           T FF  ++ W Y +    MD  YP+ I  ++ GI +      V+++NG+ YF
Sbjct: 1180TLFFSENQVWSYDDTNHVMDKDYPRLIEEVFPGIGDKVDA--VYQKNGYIYF 1329
>gb|AF144760.1|AF144760 Bos taurus MT3-MMP protein (MMP-16) mRNA, partial cds
          Length = 416

 Score =  268 bits (684), Expect = 2e-69
 Identities = 126/137 (91%), Positives = 131/137 (94%)
 Frame = +2

Query: 18  SRVLFLQTCVWILCATVCKAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           S +L+LQT +WILCATVC  EQYFNVEVWLQKYGYLPP+DPRMSVLRSAETMQSA+AAMQ
Sbjct: 5   SGILYLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPSDPRMSVLRSAETMQSALAAMQ 184

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHI YSIK
Sbjct: 185 QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHITYSIK 364

Query: 138 NVTPKVGDAETRKAIRR 154
           NVTPKVGD ETRKAIRR
Sbjct: 365 NVTPKVGDPETRKAIRR 415
>gb|BC002591.1|BC002591 Homo sapiens, matrix metalloproteinase 10 (stromelysin 2), clone
           MGC:1704 IMAGE:3140935, mRNA, complete cds
          Length = 1773

 Score =  266 bits (681), Expect = 3e-69
 Identities = 186/518 (35%), Positives = 254/518 (48%), Gaps = 18/518 (3%)
 Frame = +1

Query: 9   GSRLDFVSQSRVLFLQTCVWILCATVCKA--------EQYFNVEV---WLQKYGYLPPTD 57
           G+R   V   R++ L   V +LC  VC A        E+  N ++   +L+KY Y    D
Sbjct: 1   GTRTKKVRAVRMMHLAFLV-LLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKY-YNLEKD 174

Query: 58  PRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRR 117
            +    + +  +   I  MQ+F G+ +TGK+D +T++ M+KPRCGVPD    SS   +  
Sbjct: 175 VKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGM-- 348

Query: 118 KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELEN 177
                   KW+  H+ Y I N TP +       AI +A  VW+ VTPLTF  +       
Sbjct: 349 -------PKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLY------ 489

Query: 178 GKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
            + + DI I FA   HGD   FDG G  LAHAY PGPG+ GD HFD DE WT    +  G
Sbjct: 490 -EGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWT---EDASG 657

Query: 238 NDLFLVAVHELGHALGLEHSNDPTAIMAPFY-QYMETDNFKLPNDDLQGIQKIYGXXXXX 296
            +LFLVA HELGH+LGL HS +  A+M P Y  + E   F+L  DD+ GIQ +YG     
Sbjct: 658 TNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGP---- 825

Query: 297 XXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK--PNICDG--NFNTL 352
                           PPA                    S P     P  CD   +F+ +
Sbjct: 826 ----------------PPA----------STEEPLVPTKSVPSGSEMPAKCDPALSFDAI 927

Query: 353 VILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NSEGNFVFFKSN 411
             LR E   FKD++FWR R++   +     I+ FW  LP  +DA YE NS      FK N
Sbjct: 928 STLRGEYLFFKDRYFWR-RSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGN 1104

Query: 412 KFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSM 471
           +FW  +   +Q GYP  + TLG       ID+A+  ++  KTYFF  D+YWR+ E  +SM
Sbjct: 1105EFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSM 1284

Query: 472 DPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKS 508
           + G+P+ I   + G+   P+   V +  GF YF    S
Sbjct: 1285EQGFPRLIADDFPGV--EPKVDAVLQAFGFFYFFSGSS 1392
>gb|AF062392.1|AF062392 Gallus gallus matrix metalloproteinase mRNA, complete cds
          Length = 1587

 Score =  265 bits (678), Expect = 8e-69
 Identities = 171/488 (35%), Positives = 232/488 (47%), Gaps = 4/488 (0%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           VE +L K+  +     +     +AE     +  MQ+F+G+ +TGK D  T++ MKKPRCG
Sbjct: 162 VEDYLSKFYTIETDSNQRGWKANAEFTAEKLQKMQRFFGLKVTGKPDTETLEMMKKPRCG 341

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPD              Y +T   W+  ++ Y I N TP +      KAI++AF     V
Sbjct: 342 VPDVGL-----------YGVTLPGWKKNNLTYRIVNYTPDLSKEVVDKAIQKAFKARSTV 488

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSP-FDGEGGFLAHAYFPGPGIGGDTH 221
           TPL F  +        +   DI + F +  HG     FDG  G LAHA+ PG G GGD H
Sbjct: 489 TPLIFARIQ-------EGIADIMVAFGTKAHGHCPRYFDGPLGVLAHAFPPGSGFGGDVH 647

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FD DE WT+G+   DG +LFLVA HE+GHALGL H ND  A M P Y Y+    F L  D
Sbjct: 648 FDEDEDWTMGS---DGFNLFLVAAHEVGHALGLSHPNDQRAFMFPNYAYISPSEFPLSPD 818

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                   ++P                            
Sbjct: 819 DISGIQSIYG---------SATKTPGKRPTVP--------------------------TS 893

Query: 342 PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           PN C    +F+ +  LRRE+   K +  WRV  +       + I+ FW  LP  I A YE
Sbjct: 894 PNTCGPQISFDAVTTLRREVIFLKGRHLWRVYPDNSEVELEL-ISAFWPFLPSGIQAAYE 1070

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGD 459
           N +   +FFK N FWV     +  GYP ++ TLG       ID+A+  ++ GKT FF GD
Sbjct: 1071NMKDRILFFKGNNFWVVSGYKVLLGYPKNINTLGFPKGVKKIDAAVCNKNTGKTDFFVGD 1250

Query: 460 RYWRYGEEMRSMDPGYP-KPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRV 518
           +YWRY E  +SM+ GYP + +  + GI +     F HK  G  YF       + ++ L+ 
Sbjct: 1251KYWRYDESTQSMEKGYPRRTVNDFPGISQRIDAVFQHK--GLFYFF------HGSRQLKF 1406

Query: 519 EPGYPRSI 526
           +P   R I
Sbjct: 1407DPTAKRVI 1430
>ref|XM_058069.2| Homo sapiens matrix metalloproteinase 12 (macrophage elastase)
           (MMP12), mRNA
          Length = 1779

 Score =  145 bits (366), Expect(2) = 8e-69
 Identities = 88/268 (32%), Positives = 136/268 (49%), Gaps = 4/268 (1%)
 Frame = +3

Query: 240 LFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXX 299
           LFL AVHE+GH+LGL HS+DP A+M P Y+Y++ + F+L  DD++GIQ +YG        
Sbjct: 645 LFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE---- 812

Query: 300 XXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRR 357
                    ++ +P                      +   ++P +CD N  F+ +  +  
Sbjct: 813 ---------NQRLP----------------------NPDNSEPALCDPNLSFDAVTTVGN 899

Query: 358 EMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVF 416
           ++F FKD++FW   + R      + I+  W  LP  I+A YE    N VF FK +K+W+ 
Sbjct: 900 KIFFFKDRFFWLKVSERPKTSVNL-ISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLI 1076

Query: 417 KDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP 476
            +   +P YP  + + G       ID+A++     +TYFF  ++YWRY E  + MDPGYP
Sbjct: 1077SNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYP 1256

Query: 477 KPIT-IWKGIPESPQGAFVHKENGFTYF 503
           K IT  ++GI       F  K   + +F
Sbjct: 1257KLITKNFQGIGPKIDAVFYSKNKYYYFF 1340
 Score =  142 bits (357), Expect(2) = 8e-69
 Identities = 78/187 (41%), Positives = 101/187 (53%), Gaps = 1/187 (0%)
 Frame = +1

Query: 44  EVWLQK-YGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           E +L+K YG      P   +  S   M+  I  MQ F G+ +TG++D +T++ M  PRCG
Sbjct: 112 ERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCG 291

Query: 103 VPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           VPD         +   R    G  W+  +I Y I N TP +   +   AIR+AF VW NV
Sbjct: 292 VPD---------VHHFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNV 444

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPL F ++            DI ++FA G HGD   FDG+GG LAHA+ PG GIGGD HF
Sbjct: 445 TPLKFSKI-------NTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHF 603

Query: 223 DSDEPWT 229
           D DE WT
Sbjct: 604 DEDEFWT 624
 Score = 40.0 bits (92), Expect = 0.67
 Identities = 22/57 (38%), Positives = 32/57 (55%), Gaps = 3/57 (5%)
 Frame = +3

Query: 360  FVFKDQWFWRVRNNRVM--DGYPMQITYFWRGLPPSIDAVYENSEGNFVFFK-SNKF 413
            + F D  +WR    R M   GYP  IT  ++G+ P IDAV+ +    + FF+ SN+F
Sbjct: 1188 YFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQF 1358
>ref|XM_040728.1| Homo sapiens matrix metalloproteinase 10 (stromelysin 2) (MMP10),
           mRNA
          Length = 1743

 Score =  264 bits (675), Expect = 2e-68
 Identities = 180/498 (36%), Positives = 245/498 (49%), Gaps = 18/498 (3%)
 Frame = +2

Query: 29  ILCATVCKA--------EQYFNVEV---WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC  VC A        E+  N ++   +L+KY Y    D +    + +  +   I  MQ
Sbjct: 47  LLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKY-YNLEKDVKQFRRKDSNLIVKKIQGMQ 223

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M+KPRCGVPD    SS   +          KW+  H+ Y I 
Sbjct: 224 KFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGM---------PKWRKTHLTYRIV 376

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 377 NYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLY-------EGEADIMISFAVKEHGDFY 535

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
            FDG G  LAHAY PGPG+ GD HFD DE WT    +  G +LFLVA HELGH+LGL HS
Sbjct: 536 SFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWT---EDASGTNLFLVAAHELGHSLGLFHS 706

Query: 258 NDPTAIMAPFY-QYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  + E   F+L  DD+ GIQ +YG                     PPA 
Sbjct: 707 ANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGP--------------------PPA- 823

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAK--PNICDG--NFNTLVILRREMFVFKDQWFWRVRN 372
                              S P     P  CD   +F+ +  LR E   FKD++FWR R+
Sbjct: 824 ---------STEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWR-RS 973

Query: 373 NRVMDGYPMQITYFWRGLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLIT 431
           +   +     I+ FW  LP  +DA YE NS      FK N+FW  +   +Q GYP  + T
Sbjct: 974 HWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHT 1153

Query: 432 LGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQ 490
           LG       ID+A+  ++  KTYFF  D+YWR+ E  +SM+ G+P+ I   + G+   P+
Sbjct: 1154LGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDFPGV--EPK 1327

Query: 491 GAFVHKENGFTYFIKEKS 508
              V +  GF YF    S
Sbjct: 1328VDAVLQAFGFFYFFSGSS 1381
>ref|NM_002425.1| Homo sapiens matrix metalloproteinase 10 (stromelysin 2) (MMP10),
           mRNA
          Length = 1743

 Score =  264 bits (675), Expect = 2e-68
 Identities = 180/498 (36%), Positives = 245/498 (49%), Gaps = 18/498 (3%)
 Frame = +2

Query: 29  ILCATVCKA--------EQYFNVEV---WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC  VC A        E+  N ++   +L+KY Y    D +    + +  +   I  MQ
Sbjct: 47  LLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKY-YNLEKDVKQFRRKDSNLIVKKIQGMQ 223

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M+KPRCGVPD    SS   +          KW+  H+ Y I 
Sbjct: 224 KFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGM---------PKWRKTHLTYRIV 376

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 377 NYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLY-------EGEADIMISFAVKEHGDFY 535

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
            FDG G  LAHAY PGPG+ GD HFD DE WT    +  G +LFLVA HELGH+LGL HS
Sbjct: 536 SFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWT---EDASGTNLFLVAAHELGHSLGLFHS 706

Query: 258 NDPTAIMAPFY-QYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  + E   F+L  DD+ GIQ +YG                     PPA 
Sbjct: 707 ANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGP--------------------PPA- 823

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAK--PNICDG--NFNTLVILRREMFVFKDQWFWRVRN 372
                              S P     P  CD   +F+ +  LR E   FKD++FWR R+
Sbjct: 824 ---------STEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWR-RS 973

Query: 373 NRVMDGYPMQITYFWRGLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLIT 431
           +   +     I+ FW  LP  +DA YE NS      FK N+FW  +   +Q GYP  + T
Sbjct: 974 HWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHT 1153

Query: 432 LGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQ 490
           LG       ID+A+  ++  KTYFF  D+YWR+ E  +SM+ G+P+ I   + G+   P+
Sbjct: 1154LGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDFPGV--EPK 1327

Query: 491 GAFVHKENGFTYFIKEKS 508
              V +  GF YF    S
Sbjct: 1328VDAVLQAFGFFYFFSGSS 1381
>emb|X07820.1|HSSTROM2 Human mRNA for metalloproteinase stromelysin-2
          Length = 1743

 Score =  264 bits (675), Expect = 2e-68
 Identities = 180/498 (36%), Positives = 245/498 (49%), Gaps = 18/498 (3%)
 Frame = +2

Query: 29  ILCATVCKA--------EQYFNVEV---WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC  VC A        E+  N ++   +L+KY Y    D +    + +  +   I  MQ
Sbjct: 47  LLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKY-YNLEKDVKQFRRKDSNLIVKKIQGMQ 223

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M+KPRCGVPD    SS   +          KW+  H+ Y I 
Sbjct: 224 KFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGM---------PKWRKTHLTYRIV 376

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N TP +       AI +A  VW+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 377 NYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLY-------EGEADIMISFAVKEHGDFY 535

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
            FDG G  LAHAY PGPG+ GD HFD DE WT    +  G +LFLVA HELGH+LGL HS
Sbjct: 536 SFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWT---EDASGTNLFLVAAHELGHSLGLFHS 706

Query: 258 NDPTAIMAPFY-QYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  + E   F+L  DD+ GIQ +YG                     PPA 
Sbjct: 707 ANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGP--------------------PPA- 823

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAK--PNICDG--NFNTLVILRREMFVFKDQWFWRVRN 372
                              S P     P  CD   +F+ +  LR E   FKD++FWR R+
Sbjct: 824 ---------STEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWR-RS 973

Query: 373 NRVMDGYPMQITYFWRGLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLIT 431
           +   +     I+ FW  LP  +DA YE NS      FK N+FW  +   +Q GYP  + T
Sbjct: 974 HWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHT 1153

Query: 432 LGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQ 490
           LG       ID+A+  ++  KTYFF  D+YWR+ E  +SM+ G+P+ I   + G+   P+
Sbjct: 1154LGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDFPGV--EPK 1327

Query: 491 GAFVHKENGFTYFIKEKS 508
              V +  GF YF    S
Sbjct: 1328VDAVLQAFGFFYFFSGSS 1381
>emb|X58256.1|BTCLG Bovine CLG mRNA for collagenase
          Length = 2025

 Score =  263 bits (672), Expect = 4e-68
 Identities = 168/469 (35%), Positives = 237/469 (49%), Gaps = 8/469 (1%)
 Frame = +3

Query: 43  VEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCG 102
           V+ +L+ Y  L     ++   R+   +   +  MQ+F+G+ +TGK D  T++ MK+PRCG
Sbjct: 111 VKKYLENYYNLNSNGKKVERQRNGGLITEKLKQMQKFFGLRVTGKPDAETLNVMKQPRCG 290

Query: 103 VPDQTRGSSKFNIRRKRYALTGQK--WQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
           VPD              + LT  K  W++ ++ Y I+N TP +  A+  +AI +AF +W 
Sbjct: 291 VPDVAP-----------FVLTPGKSCWENTNLTYRIENYTPDLSRADVDQAIEKAFQLWS 437

Query: 161 NVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT 220
           NVTPLTF +V        +   DI I F  G H D+SPFDG GG LAHA+ PG GIGGD 
Sbjct: 438 NVTPLTFTKV-------SEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGAGIGGDA 596

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT    N    +L+ VA HE GH+LGL HS D  A+M P Y +  + + +L  
Sbjct: 597 HFDDDEWWT---SNFQDYNLYRVAAHEFGHSLGLAHSTDIGALMYPSYTF--SGDVQLSQ 761

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ IYG                  + + P                          
Sbjct: 762 DDIDGIQAIYGPSQNPT------------QPVGPQT------------------------ 833

Query: 341 KPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAV 397
            P +CD    F+ +  +R E+  FKD+++  +R N +     +  I+ FW  LP  + A 
Sbjct: 834 -PEVCDSKLTFDAITTIRGEVMFFKDRFY--MRTNPLYPEVELNFISVFWPQLPNGLQAA 1004

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLI-TLGSGIPSHGIDSAIWWEDVGKTYF 455
           YE ++ + V FFK NK+W  K   +  GYP D+  + G       ID+A+  ED GKTYF
Sbjct: 1005YEVADRDEVRFFKGNKYWAVKGQDVLRGYPRDIYRSFGFPRTVKSIDAAVSEEDTGKTYF 1184

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYF 503
           F  ++ WRY E  +SMD GYPK I   + GI       F  ++ GF YF
Sbjct: 1185FVANKCWRYDEYKQSMDAGYPKMIAEDFPGIGNKVDAVF--QKGGFFYF 1325
>ref|NM_008607.1| Mus musculus matrix metalloproteinase 13 (Mmp13), mRNA
          Length = 2660

 Score =  262 bits (669), Expect = 8e-68
 Identities = 167/489 (34%), Positives = 239/489 (48%), Gaps = 12/489 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+ Y Y P T   +    +  +    +  MQ F+G+ +TGK+D  T+D M+KPRCGV
Sbjct: 131 EHYLKSY-YHPATLAGILKKSTVTSTVDRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGV 307

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD      ++N+  +       KW   ++ Y I N TP +  +E  KA R+AF VW +VT
Sbjct: 308 PDV----GEYNVFPRTL-----KWSQTNLTYRIVNYTPDMSHSEVEKAFRKAFKVWSDVT 460

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F  +            DI I F +  HGD  PFDG  G LAHA+ PGP  GGD HFD
Sbjct: 461 PLNFTRIY-------DGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFD 619

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT  +    G +LF+VA HELGH+LGL+HS DP A+M P Y Y    +F LP+DD+
Sbjct: 620 DDETWTSSSK---GYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV 790

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-- 341
           QGIQ +YG                                              P  K  
Sbjct: 791 QGIQFLYGPGDED-----------------------------------------PNPKHP 847

Query: 342 --PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P  CD   + + +  LR E  +FKD++FWR+   +V +        FW  LP  +DA 
Sbjct: 848 KTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQV-EAELFLTKSFWPELPNHVDAA 1024

Query: 398 YENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+   + +F F+  KFW      +  GYP  +  LG       + +A+ +E+ GKT FF
Sbjct: 1025YEHPSRDLMFIFRGRKFWALNGYDILEGYPRKISDLGFPKEVKRLSAAVHFENTGKTLFF 1204

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----IKEKSTGN 511
             +  W Y +  ++MD  YP+ I   + GI        V+++NG+ YF    I+ + +  
Sbjct: 1205SENHVWSYDDVNQTMDKDYPRLIEEEFPGIGNKVDA--VYEKNGYIYFFNGPIQFEYSIW 1378

Query: 512 STKMLRVEP 520
           S +++RV P
Sbjct: 1379SNRIVRVMP 1405
>emb|X66473.1|MMPCOLLAG M.musculus mRNA for (pro)collagenase
          Length = 2660

 Score =  262 bits (669), Expect = 8e-68
 Identities = 167/489 (34%), Positives = 239/489 (48%), Gaps = 12/489 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+ Y Y P T   +    +  +    +  MQ F+G+ +TGK+D  T+D M+KPRCGV
Sbjct: 131 EHYLKSY-YHPATLAGILKKSTVTSTVDRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGV 307

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD      ++N+  +       KW   ++ Y I N TP +  +E  KA R+AF VW +VT
Sbjct: 308 PDV----GEYNVFPRTL-----KWSQTNLTYRIVNYTPDMSHSEVEKAFRKAFKVWSDVT 460

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F  +            DI I F +  HGD  PFDG  G LAHA+ PGP  GGD HFD
Sbjct: 461 PLNFTRIY-------DGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFD 619

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT  +    G +LF+VA HELGH+LGL+HS DP A+M P Y Y    +F LP+DD+
Sbjct: 620 DDETWTSSSK---GYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV 790

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-- 341
           QGIQ +YG                                              P  K  
Sbjct: 791 QGIQFLYGPGDED-----------------------------------------PNPKHP 847

Query: 342 --PNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P  CD   + + +  LR E  +FKD++FWR+   +V +        FW  LP  +DA 
Sbjct: 848 KTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQV-EAELFLTKSFWPELPNHVDAA 1024

Query: 398 YENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+   + +F F+  KFW      +  GYP  +  LG       + +A+ +E+ GKT FF
Sbjct: 1025YEHPSRDLMFIFRGRKFWALNGYDILEGYPRKISDLGFPKEVKRLSAAVHFENTGKTLFF 1204

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF----IKEKSTGN 511
             +  W Y +  ++MD  YP+ I   + GI        V+++NG+ YF    I+ + +  
Sbjct: 1205SENHVWSYDDVNQTMDKDYPRLIEEEFPGIGNKVDA--VYEKNGYIYFFNGPIQFEYSIW 1378

Query: 512 STKMLRVEP 520
           S +++RV P
Sbjct: 1379SNRIVRVMP 1405
>gb|AF009922.1|AF009922 Bos taurus enamel metalloproteinase precursor mRNA, complete cds
          Length = 2123

 Score =  262 bits (669), Expect = 8e-68
 Identities = 159/444 (35%), Positives = 223/444 (49%), Gaps = 6/444 (1%)
 Frame = +2

Query: 40  YFNVEVWLQKYGYLPPTDPRMS--VLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMK 97
           Y   + +L KY Y     P++   V R   +    I  +Q+F+G+ +TGK+DR T+D +K
Sbjct: 110 YRLAQAYLDKY-YTKKGGPQIGEMVARGGNSTVKKIKELQEFFGLRVTGKLDRATMDVIK 286

Query: 98  KPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFD 157
           +PRCGVPD         +   R      KW+   + Y I   TP +  AE  +A+  A  
Sbjct: 287 RPRCGVPD---------VANYRLFPGEPKWKKNTLTYRISKYTPSMTPAEVDRAMEMALR 439

Query: 158 VWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG 217
            W +  PL F  +          + DI I F +G HGDS PFDG  G LAHA+ PG G+G
Sbjct: 440 AWSSAVPLNFVRI-------NAGEADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLG 598

Query: 218 GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFK 277
           GDTHFD+ E WT+G    +G +LF VA HE GHALGL HS DP+A+M P Y+Y     F+
Sbjct: 599 GDTHFDNAEKWTMGT---NGFNLFTVAAHEFGHALGLAHSTDPSALMFPTYKYQNPYGFR 769

Query: 278 LPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSY 337
           LP DD++GIQ +YG                 + SI                         
Sbjct: 770 LPKDDVKGIQALYGPRRAFSGKPTAPHGPPHNPSI------------------------- 874

Query: 338 PGAKPNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGY-PMQITYFWRGLPPSI 394
               P++CD N  F+ + +L +E+ +F+D+ FWR R   +M G  P  IT  +  L  ++
Sbjct: 875 ----PDLCDSNLSFDAVTMLGKELLLFRDRIFWR-RQVHLMSGIRPSTITSSFPQLMSNV 1039

Query: 395 DAVYENSE-GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKT 453
           DA YE +E G   FFK   +W+ +   +Q G P  +   G       ID+A++ +D  KT
Sbjct: 1040DAAYEVAERGTAYFFKGPHYWITRGFQMQ-GPPRTIYDFGFPRYVQRIDAAVYLKDAQKT 1216

Query: 454 YFFKGDRYWRYGEEMRSMDPGYPK 477
            FF GD Y+ Y E  R M+  YPK
Sbjct: 1217LFFVGDEYYSYDERKRKMEKDYPK 1288
>ref|XM_009873.3| Homo sapiens matrix metalloproteinase 11 (stromelysin 3) (MMP11),
           mRNA
          Length = 2247

 Score =  261 bits (667), Expect = 1e-67
 Identities = 150/445 (33%), Positives = 222/445 (49%), Gaps = 2/445 (0%)
 Frame = +1

Query: 96  MKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRA 155
           ++ PRCGVPD + G S  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A
Sbjct: 232 LRPPRCGVPDPSDGLSARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEA 408

Query: 156 FDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG 215
             VW +VTPLTF EV       G+   DI I FA  +HGD  PFDG GG LAHA+FP   
Sbjct: 409 LKVWSDVTPLTFTEV-----HEGR--ADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTH 567

Query: 216 IGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDN 275
             GD HFD DE WT+G  +  G DL  VA HE GH LGL+H+    A+M+ FY +     
Sbjct: 568 REGDVHFDYDETWTIG--DDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFRYP-- 735

Query: 276 FKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXX 335
             L  DD +G+Q +YG                  +  P                      
Sbjct: 736 LSLSPDDCRGVQHLYG------------------QPWPTVTSRTPALGPQAGIDTNEIAP 861

Query: 336 SYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID 395
             P A P+ C+ +F+ +  +R E+F FK  + WR+R  ++  GYP   +  W+GLP  +D
Sbjct: 862 LEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVD 1041

Query: 396 AVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTY 454
           A +E+++G+  FF+  ++WV+       G P  L  LG    P H   + +W  +  K Y
Sbjct: 1042AAFEDAQGHIWFFQGAQYWVYDGEKPVLG-PAPLTELGLVRFPVHA--ALVWGPEKNKIY 1212

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK 514
           FF+G  YWR+    R +D   P+  T W+G+P     AF    +G+ YF++ +       
Sbjct: 1213FFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAF-QDADGYAYFLRGRLYWKFDP 1389

Query: 515 M-LRVEPGYPRSILKDFMGCDGPTD 538
           + ++   G+PR +  DF GC  P +
Sbjct: 1390VKVKALEGFPRLVGPDFFGCAEPAN 1464
>emb|X57766.1|HSSTROL3 Human stromelysin-3 mRNA
          Length = 2247

 Score =  261 bits (667), Expect = 1e-67
 Identities = 150/445 (33%), Positives = 222/445 (49%), Gaps = 2/445 (0%)
 Frame = +1

Query: 96  MKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRA 155
           ++ PRCGVPD + G S  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A
Sbjct: 232 LRPPRCGVPDPSDGLSARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEA 408

Query: 156 FDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG 215
             VW +VTPLTF EV       G+   DI I FA  +HGD  PFDG GG LAHA+FP   
Sbjct: 409 LKVWSDVTPLTFTEV-----HEGR--ADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTH 567

Query: 216 IGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDN 275
             GD HFD DE WT+G  +  G DL  VA HE GH LGL+H+    A+M+ FY +     
Sbjct: 568 REGDVHFDYDETWTIG--DDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFRYP-- 735

Query: 276 FKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXX 335
             L  DD +G+Q +YG                  +  P                      
Sbjct: 736 LSLSPDDCRGVQHLYG------------------QPWPTVTSRTPALGPQAGIDTNEIAP 861

Query: 336 SYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID 395
             P A P+ C+ +F+ +  +R E+F FK  + WR+R  ++  GYP   +  W+GLP  +D
Sbjct: 862 LEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVD 1041

Query: 396 AVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTY 454
           A +E+++G+  FF+  ++WV+       G P  L  LG    P H   + +W  +  K Y
Sbjct: 1042AAFEDAQGHIWFFQGAQYWVYDGEKPVLG-PAPLTELGLVRFPVHA--ALVWGPEKNKIY 1212

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK 514
           FF+G  YWR+    R +D   P+  T W+G+P     AF    +G+ YF++ +       
Sbjct: 1213FFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAF-QDADGYAYFLRGRLYWKFDP 1389

Query: 515 M-LRVEPGYPRSILKDFMGCDGPTD 538
           + ++   G+PR +  DF GC  P +
Sbjct: 1390VKVKALEGFPRLVGPDFFGCAEPAN 1464
>ref|NM_005940.2| Homo sapiens matrix metalloproteinase 11 (stromelysin 3) (MMP11),
           mRNA
          Length = 2260

 Score =  261 bits (667), Expect = 1e-67
 Identities = 150/445 (33%), Positives = 222/445 (49%), Gaps = 2/445 (0%)
 Frame = +2

Query: 96  MKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRA 155
           ++ PRCGVPD + G S  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A
Sbjct: 245 LRPPRCGVPDPSDGLSARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEA 421

Query: 156 FDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG 215
             VW +VTPLTF EV       G+   DI I FA  +HGD  PFDG GG LAHA+FP   
Sbjct: 422 LKVWSDVTPLTFTEV-----HEGR--ADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTH 580

Query: 216 IGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDN 275
             GD HFD DE WT+G  +  G DL  VA HE GH LGL+H+    A+M+ FY +     
Sbjct: 581 REGDVHFDYDETWTIG--DDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFRYP-- 748

Query: 276 FKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXX 335
             L  DD +G+Q +YG                  +  P                      
Sbjct: 749 LSLSPDDCRGVQHLYG------------------QPWPTVTSRTPALGPQAGIDTNEIAP 874

Query: 336 SYPGAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID 395
             P A P+ C+ +F+ +  +R E+F FK  + WR+R  ++  GYP   +  W+GLP  +D
Sbjct: 875 LEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVD 1054

Query: 396 AVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTY 454
           A +E+++G+  FF+  ++WV+       G P  L  LG    P H   + +W  +  K Y
Sbjct: 1055AAFEDAQGHIWFFQGAQYWVYDGEKPVLG-PAPLTELGLVRFPVHA--ALVWGPEKNKIY 1225

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTK 514
           FF+G  YWR+    R +D   P+  T W+G+P     AF    +G+ YF++ +       
Sbjct: 1226FFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAF-QDADGYAYFLRGRLYWKFDP 1402

Query: 515 M-LRVEPGYPRSILKDFMGCDGPTD 538
           + ++   G+PR +  DF GC  P +
Sbjct: 1403VKVKALEGFPRLVGPDFFGCAEPAN 1477
>emb|X02601.1|RNURFR1 Rat mRNA for 53 kD polypeptide induced by growth factors (EGF) and
           oncogenes (H-ras; src; polyoma middle T)
          Length = 1771

 Score =  260 bits (664), Expect = 3e-67
 Identities = 182/501 (36%), Positives = 240/501 (47%), Gaps = 15/501 (2%)
 Frame = +1

Query: 23  LQTCVWILCATVCKA------EQYFNVEV---WLQKYGYLPPTDPRMSVLRSAETMQSAI 73
           L   +W LC  VC +      E+   +EV   +L+ Y  L     + +  + +  +   I
Sbjct: 67  LPVLLW-LCTAVCSSYPLHGSEEDAGMEVLQKYLENYYGLEKDVKQFTKKKDSSPVVKKI 243

Query: 74  AAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIA 133
             MQ+F G+ MTGK+D NT++ M KPRCGVPD   G S F            KW+  HI+
Sbjct: 244 QEMQKFLGLKMTGKLDSNTMELMHKPRCGVPD-VGGFSTFP--------GSPKWRKNHIS 396

Query: 134 YSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFH 193
           Y I N T  +       AI RA  VW+ VTPLTF  +        + + DI I FA   H
Sbjct: 397 YRIVNYTLDLPRESVDSAIERALKVWEEVTPLTFSRI-------SEGEADIMISFAVEEH 555

Query: 194 GDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALG 253
           GD  PFDG G  LAHAY PGPG  GD HFD DE WT    +  G +LFLVA HELGH+LG
Sbjct: 556 GDFIPFDGPGMVLAHAYAPGPGTNGDAHFDDDERWT---DDVTGTNLFLVAAHELGHSLG 726

Query: 254 LEHSNDPTAIMAPFYQYMETD--NFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRS 311
           L HS +  A+M P Y+   TD   F L  DD+ GIQ +YG                    
Sbjct: 727 LFHSANAEALMYPVYK-SSTDLARFHLSQDDVDGIQSLYG-------------------- 843

Query: 312 IPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWR 369
            PP                       P   P +C    +F+ +  LR E+  FKD+ FWR
Sbjct: 844 -PPTESPDVLVVPTKSNSLD------PETLP-MCSSALSFDAVSTLRGEVLFFKDRHFWR 999

Query: 370 VRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHD 428
                   G+ + I+ FW  LP ++DA YE +  + VF  K N+ W  +      GYP  
Sbjct: 1000KSLRTPEPGFYL-ISSFWPSLPSNMDAAYEVTNRDTVFILKGNQIWAIRGHEELAGYPKS 1176

Query: 429 LITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPE 487
           + TLG       ID+AI  +D  KTYFF  D++WR+ E+ +SMDP +P+ I   + GI  
Sbjct: 1177IHTLGLPETVQKIDAAISLKDQKKTYFFVEDKFWRFDEKKQSMDPEFPRKIAENFPGIGT 1356

Query: 488 SPQGAFVHKENGFTYFIKEKS 508
                F  +  GF YF    S
Sbjct: 1357KVDAVF--EAFGFLYFFSGSS 1413
>dbj|D82054.1|D82054 Cynops pyrrhogaster mRNA for stromelysin-1/2-b, complete cds
          Length = 1619

 Score =  259 bits (662), Expect = 5e-67
 Identities = 169/468 (36%), Positives = 231/468 (49%), Gaps = 6/468 (1%)
 Frame = +3

Query: 42  NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           +VE +L+KY Y   +D    + ++A  +   I  MQ+F G+ +TGKVD NT++ M++PRC
Sbjct: 144 DVEEYLKKY-YGLNSDKTPDLRKAASPLAEKIREMQKFCGLQVTGKVDSNTLEVMQQPRC 320

Query: 102 GVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQN 161
           GV D     S F  R          W+   + Y I N TP +  A+   AI++AF VW +
Sbjct: 321 GVSD-VAAYSTFPGR--------PAWRTHALTYRILNYTPDMARADVDTAIQKAFKVWSD 473

Query: 162 VTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH 221
           VTPLTF ++ Y          DI I F +  HGD +PFDG  G LAHA+ PG GIGGD H
Sbjct: 474 VTPLTFTQIYY-------GTADIQISFGAREHGDFNPFDGPYGTLAHAFAPGTGIGGDAH 632

Query: 222 FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
           FD DE W+  +    G +LFLVA HE GH+LGL HSND  A+M P Y Y +   F+LP D
Sbjct: 633 FDEDEKWSKVST---GTNLFLVAAHEFGHSLGLSHSNDRNALMFPTYSYTDPARFRLPKD 803

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D+ GIQ IYG                  ++ PP                         A 
Sbjct: 804 DINGIQAIYG-----------PSRKPSPQTPPPT----------------------KPAL 884

Query: 342 PNICDG--NFNTLVILRREMFVFKDQWFWR--VRNNRVMDGYPMQITYFWRGLPPSIDAV 397
            + CD    ++ +  LR E+  F  + F R      R++      I+  W  LP  I A 
Sbjct: 885 QSYCDPAIRWDAITTLRNEILFFNGRTFLRSMPHTGRIIS---YTISAVWPSLPSGIHAA 1055

Query: 398 YENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YEN + + V  FK NK+W  K   + P YP ++ TLG       ID+A++  D  KTY+F
Sbjct: 1056YENQQKDQVLLFKGNKYWAMKGYQMLPNYPQNIYTLGLPRTVTRIDAAVYHPDTRKTYYF 1235

Query: 457 KGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF 503
             D+YW + E ++ MD   P+ I T +  I       F  K  G  YF
Sbjct: 1236VNDKYWSFDEALQVMDKDSPQQIVTTFPRIGTKVDAVFYAK--GLLYF 1373
>dbj|AB043536.1|AB043536 Oncorhynchus mykiss mmp mRNA for matrix metalloproteinase, complete
           cds
          Length = 2104

 Score =  258 bits (660), Expect = 9e-67
 Identities = 162/441 (36%), Positives = 216/441 (48%), Gaps = 11/441 (2%)
 Frame = +2

Query: 73  IAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHI 132
           ++ MQ+F+G+ +TG +D  T+  MKKPRCG+PD   G        +       KW    +
Sbjct: 581 VSEMQRFFGLKVTGTLDAETVKMMKKPRCGLPDVQLG--------RFTTFDNLKWPTNQL 736

Query: 133 AYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGF 192
            Y I+N TP +  AE   +I RA  VW  V+PL F  +        +   DI I F +  
Sbjct: 737 TYRIENYTPDMSVAEVDNSIERALQVWAKVSPLRFTRIY-------RGTADIMISFGNRN 895

Query: 193 HGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHAL 252
           HGD  PFDG  G LAHA+ PG  IGGD HFD DE +T  +    G +LFLVA HE GH+L
Sbjct: 896 HGDFYPFDGPEGTLAHAFSPGADIGGDAHFDDDEYFTFSSTR--GYNLFLVAAHEFGHSL 1069

Query: 253 GLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSI 312
           GL HSNDP A+M P Y Y E   F LP DD+ GIQ IYG                 +  +
Sbjct: 1070GLSHSNDPGALMFPVYSYTEPSTFSLPRDDVTGIQYIYG----------------PNPDV 1201

Query: 313 PPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVFKDQWFWRV 370
            P                       P + P+ CD     + +  LR E   FK ++FWR+
Sbjct: 1202NP---------------NPDKPDPTPVSTPDACDPTLVLDAVTTLRGEKMFFKGRFFWRI 1336

Query: 371 RNNRVMDGYPMQ-------ITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQ 422
                   YP         I  FW  LP +I+A YE+   + VF FK ++ W      + 
Sbjct: 1337--------YPQSSKPHQNLIKTFWPELPDNINAAYESQLSDRVFLFKDHQVWALYGYDIV 1492

Query: 423 PGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TI 481
           PGYP +L +LG       +D+A++ E   KT FF GD Y+ Y EEM+SMD G+PK +   
Sbjct: 1493PGYPRNLKSLGLPRTVKKVDAALYDEHSRKTLFFVGDNYYSYDEEMKSMDRGFPKRVDEQ 1672

Query: 482 WKGIPESPQGAFVHKENGFTY 502
           + G+      AF  +  GFTY
Sbjct: 1673FPGMTSKVTAAF--QVRGFTY 1729
>gb|U54825.1|SSU54825 Sus scrofa matrix metalloproteinase mRNA, complete cds
          Length = 3424

 Score =  256 bits (654), Expect = 5e-66
 Identities = 155/420 (36%), Positives = 212/420 (49%), Gaps = 4/420 (0%)
 Frame = +2

Query: 62  VLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYA 121
           V +   +M   I  +Q F+G+ +TGK+DR T+D +K+PRCGVPD         +   R  
Sbjct: 194 VAKGGNSMVKKIKELQAFFGLRVTGKLDRTTMDVIKRPRCGVPD---------VANYRLF 346

Query: 122 LTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRD 181
               KW+   + Y I   TP +  AE  KA+  A   W +  PL+F  V          +
Sbjct: 347 PGEPKWKKNTLTYRISKYTPSMTPAEVDKAMEMALQAWSSAVPLSFVRV-------NAGE 505

Query: 182 VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
            DI I F +G HGDS PFDG  G LAHA+ PG G+GGDTHFD+ E WT+G    +G +LF
Sbjct: 506 ADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMG---MNGFNLF 676

Query: 242 LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
            VA HE GHALGL HS DP+A+M P Y+Y     F LP DD++GIQ +YG          
Sbjct: 677 TVAAHEFGHALGLAHSTDPSALMYPTYKYQNPYGFHLPKDDVKGIQALYGPRKTFTGKPT 856

Query: 302 XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICD--GNFNTLVILRREM 359
                      PP                      +  + P+ICD   +F+ + +L +E+
Sbjct: 857 VPHG-------PP----------------------HNPSLPDICDSSSSFDAVTMLGKEL 949

Query: 360 FVFKDQWFWRVRNNRVMDGY-PMQITYFWRGLPPSIDAVYENSE-GNFVFFKSNKFWVFK 417
             F+D+ FWR R   +M G  P  IT  +  L  ++DA YE ++ G   FFK   +W+ +
Sbjct: 950 LFFRDRIFWR-RQVHLMSGIRPSTITSSFPQLMSNVDAAYEVADRGMAYFFKGPHYWITR 1126

Query: 418 DTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPK 477
              +Q G P  +   G       ID+A+  +D  KT FF GD Y+ Y E  R MD  YPK
Sbjct: 1127GFQMQ-GPPRTIYDFGFPRYVQRIDAAVHLKDTQKTLFFVGDEYYSYDERKRKMDKDYPK 1303
>ref|NM_008606.1| Mus musculus matrix metalloproteinase 11 (Mmp11), mRNA
          Length = 2246

 Score =  256 bits (654), Expect = 5e-66
 Identities = 151/447 (33%), Positives = 221/447 (48%), Gaps = 2/447 (0%)
 Frame = +2

Query: 100 RCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           RCGVPD     +  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A  VW
Sbjct: 257 RCGVPDLPDVLNARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALQVW 433

Query: 160 QNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
             VTPLTF EV       G+   DI I FA  +HGD+ PFDG GG LAHA+FP     GD
Sbjct: 434 SEVTPLTFTEV-----HEGR--ADIMIDFARYWHGDNLPFDGPGGILAHAFFPKTHREGD 592

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            HFD DE WT+G  ++ G DL  VA HE GH LGL+H+    A+M+PFY +       L 
Sbjct: 593 VHFDYDETWTIG--DNQGTDLLQVAAHEFGHVLGLQHTTAAKALMSPFYTFRYP--LSLS 760

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            DD +GIQ +YG                  R                           P 
Sbjct: 761 PDDRRGIQHLYG------------------RPQMAPTSPAPTLSSQAGTDTNEIALLEPE 886

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             P++C+ +F+ +  +R E+F FK  + WR+R+ R+  GYP   +  W+GLP  +DA +E
Sbjct: 887 TPPDVCETSFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHWQGLPSPVDAAFE 1066

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTYFFKG 458
           +++G   FF+  ++WV+       G P  L  LG  G P H   + +W  +  K YFF+G
Sbjct: 1067DAQGQIWFFQGAQYWVYDGEKPVLG-PAPLSKLGLQGSPVHA--ALVWGPEKNKIYFFRG 1237

Query: 459 DRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKM-LR 517
             YWR+    + +D   P+  T W+G+P     AF   E G+ YF++         + ++
Sbjct: 1238GDYWRFHPRTQRVDNPVPRRSTDWRGVPSEIDAAFQDAE-GYAYFLRGHLYWKFDPVKVK 1414

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRH 544
           V  G+PR +  DF  C  P +  + +H
Sbjct: 1415VLEGFPRPVGPDFFDCAEPANTFR*QH 1495
>emb|Z12604.1|MMSTRMLY3 M.musculus mRNA for stromelysin-3
          Length = 2246

 Score =  256 bits (654), Expect = 5e-66
 Identities = 151/447 (33%), Positives = 221/447 (48%), Gaps = 2/447 (0%)
 Frame = +2

Query: 100 RCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           RCGVPD     +  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A  VW
Sbjct: 257 RCGVPDLPDVLNARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALQVW 433

Query: 160 QNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
             VTPLTF EV       G+   DI I FA  +HGD+ PFDG GG LAHA+FP     GD
Sbjct: 434 SEVTPLTFTEV-----HEGR--ADIMIDFARYWHGDNLPFDGPGGILAHAFFPKTHREGD 592

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            HFD DE WT+G  ++ G DL  VA HE GH LGL+H+    A+M+PFY +       L 
Sbjct: 593 VHFDYDETWTIG--DNQGTDLLQVAAHEFGHVLGLQHTTAAKALMSPFYTFRYP--LSLS 760

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            DD +GIQ +YG                  R                           P 
Sbjct: 761 PDDRRGIQHLYG------------------RPQMAPTSPAPTLSSQAGTDTNEIALLEPE 886

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             P++C+ +F+ +  +R E+F FK  + WR+R+ R+  GYP   +  W+GLP  +DA +E
Sbjct: 887 TPPDVCETSFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHWQGLPSPVDAAFE 1066

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTYFFKG 458
           +++G   FF+  ++WV+       G P  L  LG  G P H   + +W  +  K YFF+G
Sbjct: 1067DAQGQIWFFQGAQYWVYDGEKPVLG-PAPLSKLGLQGSPVHA--ALVWGPEKNKIYFFRG 1237

Query: 459 DRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKM-LR 517
             YWR+    + +D   P+  T W+G+P     AF   E G+ YF++         + ++
Sbjct: 1238GDYWRFHPRTQRVDNPVPRRSTDWRGVPSEIDAAFQDAE-GYAYFLRGHLYWKFDPVKVK 1414

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRH 544
           V  G+PR +  DF  C  P +  + +H
Sbjct: 1415VLEGFPRPVGPDFFDCAEPANTFR*QH 1495
>ref|NM_013903.1| Mus musculus matrix metalloproteinase 20 (enamelysin) (Mmp20), mRNA
          Length = 3277

 Score =  256 bits (653), Expect = 6e-66
 Identities = 166/480 (34%), Positives = 234/480 (48%), Gaps = 10/480 (2%)
 Frame = +2

Query: 40  YFNVEVWLQKYGYLPPTDPRMS--VLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMK 97
           Y   + +L KY Y     P+    V R +  M   I  +Q F+G+ +TGK+D+NT++ +K
Sbjct: 131 YHLAQAYLDKY-YTKKGGPQAGEMVARESNPMIRRIKELQIFFGLKVTGKLDQNTMNVIK 307

Query: 98  KPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFD 157
           KPRCGVPD         +   R      KW+   + Y I   TP +   E  KAI+ A  
Sbjct: 308 KPRCGVPD---------VANYRLFPGEPKWKKNILTYRISKYTPSMSPTEVDKAIQMALH 460

Query: 158 VWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG 217
            W    PL F     + + +G  + DI I F +G HGDS PFDG  G LAHA+ PG G+G
Sbjct: 461 AWSTAVPLNF-----VRINSG--EADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLG 619

Query: 218 GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFK 277
           GDTHFD+ E WT+G    +G +LF VA HE GHALGL HS DP+A+M P Y+Y     F 
Sbjct: 620 GDTHFDNAEKWTMGT---NGFNLFTVAAHEFGHALGLGHSTDPSALMYPTYKYQNPYRFH 790

Query: 278 LPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSY 337
           LP DD++GIQ +YG                    IPP                      +
Sbjct: 791 LPKDDVKGIQALYGPRKIFPGKPTM-------PHIPP----------------------H 883

Query: 338 PGAKPNICD--GNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID 395
             + P++CD   +F+ + +L +E+  FKD+ FWR + +      P  IT  +  L  ++D
Sbjct: 884 KPSIPDLCDSSSSFDAVTMLGKELLFFKDRIFWRRQVHLPTGIRPSTITSSFPQLMSNVD 1063

Query: 396 AVYENSE-GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTY 454
           A YE +E G   FFK   +WV +   +Q G P  +   G       ID+A++ ++  KT 
Sbjct: 1064AAYEVAERGIAFFFKGPHYWVTRGFHMQ-GPPRTIYDFGFPRHVQRIDAAVYLKEPQKTL 1240

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE-----NGFTYFIKEKST 509
           FF G+ Y+ Y E  + M+  YP      K   E   G   H +     NG+ YF   + T
Sbjct: 1241FFVGEEYYSYDERKKKMEKDYP------KNTEEEFSGVSGHIDAAVELNGYIYFFSGRKT 1402
>gb|AF155933.1|AF155933 Mus musculus matrix metalloproteinase-20 (Mmp20) mRNA, complete cds
          Length = 3295

 Score =  256 bits (653), Expect = 6e-66
 Identities = 166/480 (34%), Positives = 234/480 (48%), Gaps = 10/480 (2%)
 Frame = +2

Query: 40  YFNVEVWLQKYGYLPPTDPRMS--VLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMK 97
           Y   + +L KY Y     P+    V R +  M   I  +Q F+G+ +TGK+D+NT++ +K
Sbjct: 131 YHLAQAYLDKY-YTKKGGPQAGEMVARESNPMIRRIKELQIFFGLKVTGKLDQNTMNVIK 307

Query: 98  KPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFD 157
           KPRCGVPD         +   R      KW+   + Y I   TP +   E  KAI+ A  
Sbjct: 308 KPRCGVPD---------VANYRLFPGEPKWKKNILTYRISKYTPSMSPTEVDKAIQMALH 460

Query: 158 VWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG 217
            W    PL F     + + +G  + DI I F +G HGDS PFDG  G LAHA+ PG G+G
Sbjct: 461 AWSTAVPLNF-----VRINSG--EADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLG 619

Query: 218 GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFK 277
           GDTHFD+ E WT+G    +G +LF VA HE GHALGL HS DP+A+M P Y+Y     F 
Sbjct: 620 GDTHFDNAEKWTMGT---NGFNLFTVAAHEFGHALGLGHSTDPSALMYPTYKYQNPYRFH 790

Query: 278 LPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSY 337
           LP DD++GIQ +YG                    IPP                      +
Sbjct: 791 LPKDDVKGIQALYGPRKIFPGKPTM-------PHIPP----------------------H 883

Query: 338 PGAKPNICD--GNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID 395
             + P++CD   +F+ + +L +E+  FKD+ FWR + +      P  IT  +  L  ++D
Sbjct: 884 KPSIPDLCDSSSSFDAVTMLGKELLFFKDRIFWRRQVHLPTGIRPSTITSSFPQLMSNVD 1063

Query: 396 AVYENSE-GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTY 454
           A YE +E G   FFK   +WV +   +Q G P  +   G       ID+A++ ++  KT 
Sbjct: 1064AAYEVAERGIAFFFKGPHYWVTRGFHMQ-GPPRTIYDFGFPRHVQRIDAAVYLKEPQKTL 1240

Query: 455 FFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE-----NGFTYFIKEKST 509
           FF G+ Y+ Y E  + M+  YP      K   E   G   H +     NG+ YF   + T
Sbjct: 1241FFVGEEYYSYDERKKKMEKDYP------KNTEEEFSGVSGHIDAAVELNGYIYFFSGRKT 1402
>gb|AF281673.1|AF281673 Tupaia belangeri matrix metalloproteinase-27 mRNA, complete cds
          Length = 1667

 Score =  255 bits (652), Expect = 8e-66
 Identities = 164/447 (36%), Positives = 218/447 (48%), Gaps = 5/447 (1%)
 Frame = +1

Query: 64  RSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT 123
           ++   +   I  MQ F+G+ +TG +D NT++ MK PRCGVPD         + +  Y L 
Sbjct: 253 KNGSLLDGKIREMQAFFGLTVTGTLDSNTLEIMKTPRCGVPD---------VGQYGYTLP 405

Query: 124 GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVD 183
           G  W+  ++ Y I N TP +  A+  +AI++A +VW  VTPLTF ++        K   D
Sbjct: 406 G--WRKYNLTYRIMNYTPDMARADVDEAIQKALEVWSKVTPLTFTKI-------FKGIAD 558

Query: 184 ITIIFASGFHGDSSP-FDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFL 242
           I I F +  HG     FDG  G L HA+ PG G+GGDTHFD DE WT       G  LFL
Sbjct: 559 IMIAFRTRVHGRCPRYFDGPLGVLGHAFPPGLGLGGDTHFDEDENWTKDTA---GFSLFL 729

Query: 243 VAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXX 302
           VA HE GHALGL HSND TA+M P Y  ++   + L  DD+ GIQ IYG           
Sbjct: 730 VAAHEFGHALGLSHSNDQTALMFPNYVSLDPSKYPLSQDDIDGIQSIYG----------- 876

Query: 303 XXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK-PNICDGN--FNTLVILRREM 359
                    +P                         G K P+ CD +  F+ +  +RRE+
Sbjct: 877 --------GLP------------------TTPSKPKGPKIPHACDPDLTFDAITNIRREV 978

Query: 360 FVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDT 419
             FK +  WR+ ++ + D     I  FW  LP  + A YEN     + FK   FW+    
Sbjct: 979 MFFKGRHLWRIYHD-ITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIGAY 1155

Query: 420 TLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI 479
            + P YP  +  LG       ID+A+  +D  KTYFF G   WRY E  R+MD GYP+ I
Sbjct: 1156NVLPRYPRSIHILGFPRYVKKIDAAVCDQDTRKTYFFVGIWCWRYDEMTRTMDRGYPQRI 1335

Query: 480 T-IWKGIPESPQGAFVHKENGFTYFIK 505
              + GI      AF HK  GF YF +
Sbjct: 1336VRHFPGIGLRVDAAFQHK--GFFYFFR 1410
>emb|Y12779.1|HSENAMELY H.sapiens mRNA for enamelysin
          Length = 1674

 Score =  255 bits (652), Expect = 8e-66
 Identities = 157/452 (34%), Positives = 223/452 (48%), Gaps = 4/452 (0%)
 Frame = +2

Query: 62  VLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYA 121
           V R + +M   I  +Q F+G+ +TGK+D+ T++ +KKPRCGVPD         +   R  
Sbjct: 194 VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPD---------VANYRLF 346

Query: 122 LTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRD 181
               KW+   + Y I   TP +   E  KA+  A   W +  PL+F     + + +G  +
Sbjct: 347 PGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSF-----VRINSG--E 505

Query: 182 VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
            DI I F +G HGDS PFDG  G LAHA+ PG G+GGDTHFD+ E WT+G    +G +LF
Sbjct: 506 ADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNPEKWTMGT---NGFNLF 676

Query: 242 LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
            VA HE GHALGL HS DP+A+M P Y+Y     F LP DD++GIQ +YG          
Sbjct: 677 TVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPT 856

Query: 302 XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICD--GNFNTLVILRREM 359
                    SI                             P++CD   +F+ + +L +E+
Sbjct: 857 LPHAPHHKPSI-----------------------------PDLCDSSSSFDAVTMLGKEL 949

Query: 360 FVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSE-GNFVFFKSNKFWVFKD 418
            +FKD+ FWR + +      P  IT  +  L  ++DA YE +E G   FFK   +W+ + 
Sbjct: 950 LLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRG 1129

Query: 419 TTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKP 478
             +Q G P  +   G       ID+A++  +  KT FF GD Y+ Y E  R M+  YPK 
Sbjct: 1130FQMQ-GPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKN 1306

Query: 479 I-TIWKGIPESPQGAFVHKENGFTYFIKEKST 509
               + G+      A   + NG+ YF     T
Sbjct: 1307TEEEFSGVNGQIDAAV--ELNGYIYFFSGPKT 1396
>ref|NM_004771.2| Homo sapiens matrix metalloproteinase 20 (enamelysin) (MMP20), mRNA
          Length = 1958

 Score =  255 bits (652), Expect = 8e-66
 Identities = 157/452 (34%), Positives = 223/452 (48%), Gaps = 4/452 (0%)
 Frame = +2

Query: 62  VLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYA 121
           V R + +M   I  +Q F+G+ +TGK+D+ T++ +KKPRCGVPD         +   R  
Sbjct: 194 VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPD---------VANYRLF 346

Query: 122 LTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRD 181
               KW+   + Y I   TP +   E  KA+  A   W +  PL+F     + + +G  +
Sbjct: 347 PGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSF-----VRINSG--E 505

Query: 182 VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF 241
            DI I F +G HGDS PFDG  G LAHA+ PG G+GGDTHFD+ E WT+G    +G +LF
Sbjct: 506 ADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNPEKWTMGT---NGFNLF 676

Query: 242 LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXX 301
            VA HE GHALGL HS DP+A+M P Y+Y     F LP DD++GIQ +YG          
Sbjct: 677 TVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPT 856

Query: 302 XXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICD--GNFNTLVILRREM 359
                    SI                             P++CD   +F+ + +L +E+
Sbjct: 857 LPHAPHHKPSI-----------------------------PDLCDSSSSFDAVTMLGKEL 949

Query: 360 FVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSE-GNFVFFKSNKFWVFKD 418
            +FKD+ FWR + +      P  IT  +  L  ++DA YE +E G   FFK   +W+ + 
Sbjct: 950 LLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRG 1129

Query: 419 TTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKP 478
             +Q G P  +   G       ID+A++  +  KT FF GD Y+ Y E  R M+  YPK 
Sbjct: 1130FQMQ-GPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKN 1306

Query: 479 I-TIWKGIPESPQGAFVHKENGFTYFIKEKST 509
               + G+      A   + NG+ YF     T
Sbjct: 1307TEEEFSGVNGQIDAAV--ELNGYIYFFSGPKT 1396
>gb|U62529.1|ECU62529 Equus caballus matrix metalloproteinase 3 mRNA, complete cds
          Length = 1804

 Score =  255 bits (651), Expect = 1e-65
 Identities = 173/496 (34%), Positives = 240/496 (47%), Gaps = 16/496 (3%)
 Frame = +2

Query: 29  ILCATVCKA--------EQYFNVEV---WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQ 77
           +LC   C A        ++  N+++   +L+KY  L     +    + +  +   I  MQ
Sbjct: 77  LLCVAACSAYPLDRSARDEDSNMDLLQDYLEKYYDLGKEMRQYVRRKDSGPIVKKIQEMQ 256

Query: 78  QFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIK 137
           +F G+ +TGK+D +T++ M K RCGVPD    ++   +          KW   H+ Y I 
Sbjct: 257 KFLGLKVTGKLDSDTVEVMHKSRCGVPDVGHFTTFPGM---------PKWSKTHLTYRIV 409

Query: 138 NVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSS 197
           N T  +        + +A  +W+ VTPLTF  +        + + DI I FA   HGD  
Sbjct: 410 NYTQDLPRDAVDSDVEKALKIWEEVTPLTFSRIY-------EGEADIMITFAVREHGDFF 568

Query: 198 PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHS 257
           PFDG G  LAHAY PGPG+ GD HFD DE WT    +  G +  LVA HELGH+LGL HS
Sbjct: 569 PFDGPGKVLAHAYPPGPGMNGDAHFDDDEHWT---KDASGINFLLVAAHELGHSLGLYHS 739

Query: 258 NDPTAIMAPFYQYME-TDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAX 316
            +  A+M P Y  ++     +L  DD+ GIQ +YG                     PPA 
Sbjct: 740 TNTEALMYPLYNTLKGPARVRLSQDDVTGIQSLYGPPPASPDSPVEPS-----EPEPPA- 901

Query: 317 XXXXXXXXXXXXXXXXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNR 374
                                PG    +CD   +F+ +  LR E+  FKD++FWR +  R
Sbjct: 902 ---------------------PGTLA-MCDPALSFDAISTLRGEILFFKDRYFWR-KTFR 1012

Query: 375 VMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLG 433
            +      I+ FW  LP  IDA YE +  + VF FK NKFW  +    Q GYP  + TLG
Sbjct: 1013TLVPEFHPISSFWPSLPSGIDAAYEVTSRDSVFIFKGNKFWAIRGNEEQAGYPRGIHTLG 1192

Query: 434 SGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGA 492
                  ID+AI+ ++  KTYFF  D+YWR+ E+ +SM+PGYPK I   + GI      A
Sbjct: 1193FPPTVRKIDAAIFDKEKQKTYFFVEDKYWRFDEKRQSMEPGYPKQIAEDFPGIDSKLDAA 1372

Query: 493 FVHKENGFTYFIKEKS 508
           F  +  GF YF    S
Sbjct: 1373F--ESFGFFYFFSGSS 1414
 Score = 63.5 bits (153), Expect = 6e-08
 Identities = 50/151 (33%), Positives = 72/151 (47%), Gaps = 5/151 (3%)
 Frame = +2

Query: 393  SIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGK 452
            S DA+     G  +FFK   FW     TL P + H + +    +PS GID+A        
Sbjct: 935  SFDAI-STLRGEILFFKDRYFWRKTFRTLVPEF-HPISSFWPSLPS-GIDAAYEVTSRDS 1105

Query: 453  TYFFKGDRYWRY-GEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTYF-IKEK 507
             + FKG+++W   G E ++   GYP+ I    G P + +    A   KE   TYF +++K
Sbjct: 1106 VFIFKGNKFWAIRGNEEQA---GYPRGIHTL-GFPPTVRKIDAAIFDKEKQKTYFFVEDK 1273

Query: 508  STGNSTKMLRVEPGYPRSILKDFMGCDGPTD 538
                  K   +EPGYP+ I +DF G D   D
Sbjct: 1274 YWRFDEKRQSMEPGYPKQIAEDFPGIDSKLD 1366
>gb|BC019135.1|BC019135 Mus musculus, Similar to matrix metalloproteinase 12, clone
           MGC:29351 IMAGE:5037674, mRNA, complete cds
          Length = 1822

 Score =  254 bits (648), Expect = 2e-65
 Identities = 147/436 (33%), Positives = 214/436 (48%), Gaps = 5/436 (1%)
 Frame = +3

Query: 50  YGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRG 109
           Y Y     P      +   ++  +  MQQF+G+  TG++D +T+  M  PRCGVPD    
Sbjct: 147 YDYGKDRIPMTKTKTNRNFLEEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPD---- 314

Query: 110 SSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEE 169
                ++  R      +W  +++ Y I N TP +   +     ++AF VW +VTPL F +
Sbjct: 315 -----VQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRK 479

Query: 170 VPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWT 229
           +        K + DI I+FA G HGD + FDG+GG LAHA++PGPGI GD HFD  E WT
Sbjct: 480 LH-------KDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWT 638

Query: 230 LGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKI 289
               +  G +LFLVAVHELGH+LGL+HSN+P +IM P Y+Y+  + F+L  DD++ IQ +
Sbjct: 639 ---KSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMDPTYRYLNPNTFRLSADDIRNIQSL 809

Query: 290 YGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNF 349
           YG                   S PP+                                +F
Sbjct: 810 YG--------APVKTPSLTKPSSPPSTFCHQSL-------------------------SF 890

Query: 350 NTLVILRREMFVFKDQWFWRVRNNRVMDGYP----MQITYFWRGLPPSIDAVYENSEGNF 405
           + +  +  ++F FKD +FW       + G P    + I+  W  +P  I A YE    N 
Sbjct: 891 DAVTTVGEKIFFFKDWFFW-----WKLPGSPATNIISISSIWPSIPSGIQAAYEIESRNQ 1055

Query: 406 VF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRY 464
           +F FK  K+W+  +   +P YP  + +LG       +D+A++     K YFF   +YWRY
Sbjct: 1056LFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKQYWRY 1235

Query: 465 GEEMRSMDPGYPKPIT 480
                 MDP YPK I+
Sbjct: 1236DVRQELMDPAYPKLIS 1283
>dbj|AB028240.1|AB028240 Salmo salar mRNA for matrix metalloproteinase 13, complete cds
          Length = 1714

 Score =  253 bits (647), Expect = 3e-65
 Identities = 168/483 (34%), Positives = 241/483 (49%), Gaps = 8/483 (1%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L++Y Y  P   +     S    +  I  MQ+F+ +N+TGK+D +T++ M+  RCGV
Sbjct: 109 EKYLRRY-YGMPAGLQGKEKTSDVMYKKKIQEMQEFFKLNVTGKLDDDTLELMEMARCGV 285

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD         +    +     KW+   + + I N TP +  A+  +A+R   +VW +VT
Sbjct: 286 PD---------VAEYNHFPNDLKWKTTEVTFRILNYTPDLRKADVDRAVRNGLNVWSSVT 438

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL F+++        + + DI I F +  HGD +PFDG  G LAHAY PG GIGGDTHFD
Sbjct: 439 PLKFKKLY-------EGNADIMISFGAREHGDFNPFDGPDGLLAHAYPPGNGIGGDTHFD 597

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE WT     H+ N LFLVA HE GHALG+ HS+DP ++M P Y Y +   + L  DD+
Sbjct: 598 EDETWT--KDFHEFN-LFLVAAHEFGHALGMAHSSDPGSLMYPVYSYGK--GYPLSEDDI 762

Query: 284 QGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPN 343
           +GIQ +YG                 HR I P                       P A P+
Sbjct: 763 KGIQSLYG-------------ENPNHRRIKPK----------------------PDA-PS 834

Query: 344 ICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS 401
            CD   +F+ +  LR E  +FKD+++WR+ ++++ +     I   W  +P  +DA YEN 
Sbjct: 835 KCDPELSFDAVTELRGETIIFKDRFYWRL-HSQIPEPEQTLIKSTWPEIPNKVDAAYENP 1011

Query: 402 EGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDR 460
           E + V  F   K W      L  GYP  +  LG       ID+A+   D GKT  F  + 
Sbjct: 1012EKDVVIIFSGIKMWALNGYNLVDGYPKYIHKLGLPKTVRKIDAAVNIRDTGKTLLFVEEE 1191

Query: 461 YWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKE----KSTGNSTKM 515
           YW Y E   +MD GYP+ I   + GI +    A  H   G+ YF  E    + + NS K+
Sbjct: 1192YWSYDERTGTMDSGYPRSIEEDFPGIGDEVDAAAYH--FGYLYFYHEHIQFEYSYNSRKV 1365

Query: 516 LRV 518
           +R+
Sbjct: 1366MRI 1374
>ref|NM_032006.1| Mus musculus collagenase-like A (Mcola-pending), mRNA
          Length = 1525

 Score =  253 bits (645), Expect = 5e-65
 Identities = 164/445 (36%), Positives = 224/445 (49%), Gaps = 9/445 (2%)
 Frame = +2

Query: 67  ETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT--G 124
           E M   +  MQQ +G+ +TG  D  T+  MKKPRCGVPD              YA+T   
Sbjct: 173 EMMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAP-----------YAITHNN 319

Query: 125 QKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDI 184
            +W   H+ YSI N TP +  A    AI RAF VW +VTPLTF+ V        + + DI
Sbjct: 320 PRWTKTHLTYSILNYTPYLPKAVVEDAIARAFRVWSDVTPLTFQRV-------FEEEGDI 478

Query: 185 TIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVA 244
            + F  G HGD++PFDG    LAH + PGPG+GGD H+D DE WT  + N    +LF V 
Sbjct: 479 VLSFHRGDHGDNNPFDGPNYKLAHTFQPGPGLGGDVHYDLDETWTNSSENF---NLFYVT 649

Query: 245 VHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXX 304
            HELGH+LGL HS+D  A+M P Y +  T++F L  DD+  IQ +YG             
Sbjct: 650 AHELGHSLGLTHSSDIGALMFPSYTWY-TEDFVLNQDDINRIQDLYG------------- 787

Query: 305 XXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVF 362
                  I P                           P+ C+G+  F+ +   R E+F F
Sbjct: 788 --PSPNPIQPTGATT----------------------PHPCNGDLTFDAITTFRGEVFFF 895

Query: 363 KDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAVYENSEGNFV-FFKSNKFWVFKDTT 420
           K +++ RV  NR M    +  I   W  LP  +DA YE S  + V +FK +K W  ++ +
Sbjct: 896 KGRFYIRV--NRFMPEPELNLIGILWPNLPVKLDAAYEASMIDQVRYFKGSKVWAVQEQS 1069

Query: 421 LQPGYPHDLITLGSGIPSH--GIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPK- 477
           +  G+P D+ +   G PS+   ID+A+  E+ GKTYFF    YWRY E  +SMDPGYP+ 
Sbjct: 1070VLRGFPRDIHSF-FGFPSNVTHIDAAVCEEETGKTYFFVDHMYWRYDENTQSMDPGYPRL 1246

Query: 478 PITIWKGIPESPQGAFVHKENGFTY 502
               + GI +     F   EN + +
Sbjct: 1247TAEDFPGIDDKVDDVFQKGENFYFF 1321
>emb|AJ278462.1|MMU278462 Mus musculus mRNA for putative matrix metalloproteinase (McolA
           gene)
          Length = 1525

 Score =  253 bits (645), Expect = 5e-65
 Identities = 164/445 (36%), Positives = 224/445 (49%), Gaps = 9/445 (2%)
 Frame = +2

Query: 67  ETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT--G 124
           E M   +  MQQ +G+ +TG  D  T+  MKKPRCGVPD              YA+T   
Sbjct: 173 EMMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAP-----------YAITHNN 319

Query: 125 QKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDI 184
            +W   H+ YSI N TP +  A    AI RAF VW +VTPLTF+ V        + + DI
Sbjct: 320 PRWTKTHLTYSILNYTPYLPKAVVEDAIARAFRVWSDVTPLTFQRV-------FEEEGDI 478

Query: 185 TIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVA 244
            + F  G HGD++PFDG    LAH + PGPG+GGD H+D DE WT  + N    +LF V 
Sbjct: 479 VLSFHRGDHGDNNPFDGPNYKLAHTFQPGPGLGGDVHYDLDETWTNSSENF---NLFYVT 649

Query: 245 VHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXX 304
            HELGH+LGL HS+D  A+M P Y +  T++F L  DD+  IQ +YG             
Sbjct: 650 AHELGHSLGLTHSSDIGALMFPSYTWY-TEDFVLNQDDINRIQDLYG------------- 787

Query: 305 XXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMFVF 362
                  I P                           P+ C+G+  F+ +   R E+F F
Sbjct: 788 --PSPNPIQPTGATT----------------------PHPCNGDLTFDAITTFRGEVFFF 895

Query: 363 KDQWFWRVRNNRVMDGYPMQ-ITYFWRGLPPSIDAVYENSEGNFV-FFKSNKFWVFKDTT 420
           K +++ RV  NR M    +  I   W  LP  +DA YE S  + V +FK +K W  ++ +
Sbjct: 896 KGRFYIRV--NRFMPEPELNLIGILWPNLPVKLDAAYEASMIDQVRYFKGSKVWAVQEQS 1069

Query: 421 LQPGYPHDLITLGSGIPSH--GIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPK- 477
           +  G+P D+ +   G PS+   ID+A+  E+ GKTYFF    YWRY E  +SMDPGYP+ 
Sbjct: 1070VLRGFPRDIHSF-FGFPSNVTHIDAAVCEEETGKTYFFVDHMYWRYDENTQSMDPGYPRL 1246

Query: 478 PITIWKGIPESPQGAFVHKENGFTY 502
               + GI +     F   EN + +
Sbjct: 1247TAEDFPGIDDKVDDVFQKGENFYFF 1321
>ref|NM_012980.1| Rattus norvegicus Matrix metalloproteinase 11 (stromelysin 3)
           (Mmp11), mRNA
          Length = 2236

 Score =  250 bits (638), Expect = 3e-64
 Identities = 149/447 (33%), Positives = 217/447 (48%), Gaps = 2/447 (0%)
 Frame = +1

Query: 100 RCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           RCGVPD     +  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A  VW
Sbjct: 262 RCGVPDPPDVLNARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALRVW 438

Query: 160 QNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
             VTPLTF EV       G+   DI I F   +HGD+ PFDG GG LAHA+FP     GD
Sbjct: 439 SEVTPLTFTEV-----HEGR--ADIMIDFTRYWHGDNLPFDGPGGILAHAFFPKTHREGD 597

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            HFD DE WT+G+    G DL  VA HE GH LGL+H+    A+M+PFY +       L 
Sbjct: 598 VHFDYDETWTIGD---KGTDLLQVAAHEFGHVLGLQHTTAAKALMSPFYTFRYP--LSLS 762

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            DD +GIQ +YG                  R                           P 
Sbjct: 763 PDDRRGIQHLYG------------------RPQLTPTSPTPTLSSQAGTDTNEIALQEPE 888

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             P +C+ +F+ +  +R E+F FK  + WR+R+ ++  GYP   +  W+GLP  +DA +E
Sbjct: 889 VPPEVCETSFDAVSTIRGELFFFKAGFVWRLRSGQLQPGYPALASRHWQGLPSPVDAAFE 1068

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTYFFKG 458
           +++G   FF+  ++WV+       G P  L  LG  G P H   + +W  +  K YFF+G
Sbjct: 1069DAQGQIWFFQGAQYWVYDGEKPVLG-PAPLSKLGLQGSPVHA--ALVWGPEKNKIYFFRG 1239

Query: 459 DRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKM-LR 517
             YWR+    + +D   P+  T W+G+P     AF   E G+ YF++         + ++
Sbjct: 1240GDYWRFHPRTQRVDNPVPRRTTDWRGVPSEIDAAFQDAE-GYAYFLRGHLYWKFDPVKVK 1416

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRH 544
           V   +PR I  DF  C  P +  + +H
Sbjct: 1417VLESFPRPIGPDFFDCAEPANTFR*QH 1497
>gb|U46034.1|RNU46034 Rattus norvegicus stromelysin 3 mRNA, complete cds
          Length = 2236

 Score =  250 bits (638), Expect = 3e-64
 Identities = 149/447 (33%), Positives = 217/447 (48%), Gaps = 2/447 (0%)
 Frame = +1

Query: 100 RCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
           RCGVPD     +  N R+KR+ L+G +W+   + Y I     ++   + R+ +  A  VW
Sbjct: 262 RCGVPDPPDVLNARN-RQKRFVLSGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALRVW 438

Query: 160 QNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
             VTPLTF EV       G+   DI I F   +HGD+ PFDG GG LAHA+FP     GD
Sbjct: 439 SEVTPLTFTEV-----HEGR--ADIMIDFTRYWHGDNLPFDGPGGILAHAFFPKTHREGD 597

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            HFD DE WT+G+    G DL  VA HE GH LGL+H+    A+M+PFY +       L 
Sbjct: 598 VHFDYDETWTIGD---KGTDLLQVAAHEFGHVLGLQHTTAAKALMSPFYTFRYP--LSLS 762

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            DD +GIQ +YG                  R                           P 
Sbjct: 763 PDDRRGIQHLYG------------------RPQLTPTSPTPTLSSQAGTDTNEIALQEPE 888

Query: 340 AKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             P +C+ +F+ +  +R E+F FK  + WR+R+ ++  GYP   +  W+GLP  +DA +E
Sbjct: 889 VPPEVCETSFDAVSTIRGELFFFKAGFVWRLRSGQLQPGYPALASRHWQGLPSPVDAAFE 1068

Query: 400 NSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLG-SGIPSHGIDSAIWWEDVGKTYFFKG 458
           +++G   FF+  ++WV+       G P  L  LG  G P H   + +W  +  K YFF+G
Sbjct: 1069DAQGQIWFFQGAQYWVYDGEKPVLG-PAPLSKLGLQGSPVHA--ALVWGPEKNKIYFFRG 1239

Query: 459 DRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKM-LR 517
             YWR+    + +D   P+  T W+G+P     AF   E G+ YF++         + ++
Sbjct: 1240GDYWRFHPRTQRVDNPVPRRTTDWRGVPSEIDAAFQDAE-GYAYFLRGHLYWKFDPVKVK 1416

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRH 544
           V   +PR I  DF  C  P +  + +H
Sbjct: 1417VLESFPRPIGPDFFDCAEPANTFR*QH 1497
>ref|NM_008605.1| Mus musculus matrix metalloproteinase 12 (Mmp12), mRNA
          Length = 1790

 Score =  249 bits (635), Expect = 7e-64
 Identities = 147/439 (33%), Positives = 215/439 (48%), Gaps = 8/439 (1%)
 Frame = +1

Query: 50  YGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRG 109
           Y Y     P      +   ++  +  MQQF+G+  TG++D +T+  M  PRCGVPD    
Sbjct: 100 YDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPD---- 267

Query: 110 SSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEE 169
                ++  R      +W  +++ Y I N TP +   +     ++AF VW +VTPL F +
Sbjct: 268 -----VQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRK 432

Query: 170 VPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWT 229
           +        K + DI I+FA G HGD + FDG+GG LAH ++PGPGI GD HFD  E WT
Sbjct: 433 LH-------KDEADIMILFAFGAHGDFNYFDGKGGTLAHVFYPGPGIQGDAHFDEAETWT 591

Query: 230 LGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKI 289
               +  G +LFLVAVHELGH+LGL+HSN+P +IM P Y+Y+    F+L  DD++ IQ +
Sbjct: 592 ---KSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSL 762

Query: 290 YGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPN-ICDG- 347
           YG                     PP+                    + P + P+  C   
Sbjct: 763 YGAPVK-----------------PPS-------------------LTKPSSPPSTFCHQS 834

Query: 348 -NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYP----MQITYFWRGLPPSIDAVYENSE 402
            +F+ +  +  ++  FKD +FW       + G P      I+  W  +P +I A YE   
Sbjct: 835 LSFDAVTTVGEKILFFKDWFFW-----WKLPGSPATNITSISSIWPSIPSAIQAAYEIES 999

Query: 403 GNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
            N +F FK  K+W+  +   +P YP  + +LG       +D+A++     K YFF    Y
Sbjct: 1000RNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHY 1179

Query: 462 WRYGEEMRSMDPGYPKPIT 480
           WRY      MDP YPK I+
Sbjct: 1180WRYDVRQELMDPAYPKLIS 1236
>gb|M82831.1|MUSMETELAS Mus musculus macrophage metalloelastase mRNA, complete cds
          Length = 1790

 Score =  249 bits (635), Expect = 7e-64
 Identities = 147/439 (33%), Positives = 215/439 (48%), Gaps = 8/439 (1%)
 Frame = +1

Query: 50  YGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRG 109
           Y Y     P      +   ++  +  MQQF+G+  TG++D +T+  M  PRCGVPD    
Sbjct: 100 YDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPD---- 267

Query: 110 SSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEE 169
                ++  R      +W  +++ Y I N TP +   +     ++AF VW +VTPL F +
Sbjct: 268 -----VQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRK 432

Query: 170 VPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWT 229
           +        K + DI I+FA G HGD + FDG+GG LAH ++PGPGI GD HFD  E WT
Sbjct: 433 LH-------KDEADIMILFAFGAHGDFNYFDGKGGTLAHVFYPGPGIQGDAHFDEAETWT 591

Query: 230 LGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKI 289
               +  G +LFLVAVHELGH+LGL+HSN+P +IM P Y+Y+    F+L  DD++ IQ +
Sbjct: 592 ---KSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSL 762

Query: 290 YGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPN-ICDG- 347
           YG                     PP+                    + P + P+  C   
Sbjct: 763 YGAPVK-----------------PPS-------------------LTKPSSPPSTFCHQS 834

Query: 348 -NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYP----MQITYFWRGLPPSIDAVYENSE 402
            +F+ +  +  ++  FKD +FW       + G P      I+  W  +P +I A YE   
Sbjct: 835 LSFDAVTTVGEKILFFKDWFFW-----WKLPGSPATNITSISSIWPSIPSAIQAAYEIES 999

Query: 403 GNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
            N +F FK  K+W+  +   +P YP  + +LG       +D+A++     K YFF    Y
Sbjct: 1000RNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHY 1179

Query: 462 WRYGEEMRSMDPGYPKPIT 480
           WRY      MDP YPK I+
Sbjct: 1180WRYDVRQELMDPAYPKLIS 1236
>ref|NM_053963.1| Rattus norvegicus matrix metalloproteinase 12 (Mmp12), mRNA
          Length = 1632

 Score =  248 bits (633), Expect = 1e-63
 Identities = 146/428 (34%), Positives = 214/428 (49%), Gaps = 5/428 (1%)
 Frame = +3

Query: 58  PRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRR 117
           P      +   ++  +  MQQF+G+ +TG++D +T+  M   RCGVPD         ++ 
Sbjct: 177 PMTKTKTNRNLLEEKLQEMQQFFGLEVTGQLDTSTLKIMHTSRCGVPD---------VQH 329

Query: 118 KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELEN 177
            R      +W  +++ Y I N TP +  A+     ++AF VW +VTPL F ++       
Sbjct: 330 LRAVPQRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIH------ 491

Query: 178 GKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
            K + DITI+FA G HGD   FDG+GG LAHA++PGPGI GD HFD  E WT    +  G
Sbjct: 492 -KGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWT---KSFQG 659

Query: 238 NDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXX 297
            +LFLVAVHELGH+LGL HSN+P +IM P Y+Y+  + F+L  DD+  IQ +YG      
Sbjct: 660 TNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYG------ 821

Query: 298 XXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPN-ICDG--NFNTLVI 354
                                                 + PG+ P+ +C    +F+ +  
Sbjct: 822 ------------------------------APVKNPSLTNPGSPPSTVCHQSLSFDAVTT 911

Query: 355 LRREMFVFKDQWF-WRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNK 412
           +  ++F FKD +F WR+  +   +     I+  W  +P  I A YE    N +F FK  K
Sbjct: 912 VGDKIFFFKDWFFWWRLPGSPATN--ITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEK 1085

Query: 413 FWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMD 472
           +W+  +   +P YP  + +LG       ID+A++     K YFF   +YWRY      MD
Sbjct: 1086YWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMD 1265

Query: 473 PGYPKPIT 480
             YPK I+
Sbjct: 1266AAYPKLIS 1289
>emb|X98517.1|RNMME R.norvegicus mRNA for macrophage metalloelastase (MME)
          Length = 1632

 Score =  248 bits (633), Expect = 1e-63
 Identities = 146/428 (34%), Positives = 214/428 (49%), Gaps = 5/428 (1%)
 Frame = +3

Query: 58  PRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRR 117
           P      +   ++  +  MQQF+G+ +TG++D +T+  M   RCGVPD         ++ 
Sbjct: 177 PMTKTKTNRNLLEEKLQEMQQFFGLEVTGQLDTSTLKIMHTSRCGVPD---------VQH 329

Query: 118 KRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELEN 177
            R      +W  +++ Y I N TP +  A+     ++AF VW +VTPL F ++       
Sbjct: 330 LRAVPQRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIH------ 491

Query: 178 GKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
            K + DITI+FA G HGD   FDG+GG LAHA++PGPGI GD HFD  E WT    +  G
Sbjct: 492 -KGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWT---KSFQG 659

Query: 238 NDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXX 297
            +LFLVAVHELGH+LGL HSN+P +IM P Y+Y+  + F+L  DD+  IQ +YG      
Sbjct: 660 TNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYG------ 821

Query: 298 XXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPN-ICDG--NFNTLVI 354
                                                 + PG+ P+ +C    +F+ +  
Sbjct: 822 ------------------------------APVKNPSLTNPGSPPSTVCHQSLSFDAVTT 911

Query: 355 LRREMFVFKDQWF-WRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVF-FKSNK 412
           +  ++F FKD +F WR+  +   +     I+  W  +P  I A YE    N +F FK  K
Sbjct: 912 VGDKIFFFKDWFFWWRLPGSPATN--ITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEK 1085

Query: 413 FWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMD 472
           +W+  +   +P YP  + +LG       ID+A++     K YFF   +YWRY      MD
Sbjct: 1086YWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMD 1265

Query: 473 PGYPKPIT 480
             YPK I+
Sbjct: 1266AAYPKLIS 1289
>gb|AF070478.1|AF070478 Gallus gallus matrix metalloproteinase-13 (MMP-13) mRNA, partial
           cds
          Length = 1487

 Score =  247 bits (631), Expect = 2e-63
 Identities = 156/409 (38%), Positives = 204/409 (49%), Gaps = 4/409 (0%)
 Frame = +1

Query: 99  PRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDV 158
           PRCGVPD   G  KF  R+        KW + ++ Y I + T  +  AE  +A +RAF V
Sbjct: 1   PRCGVPDV--GEYKFFPRKL-------KWSNTNLTYRIMSYTSDLRRAEVERAFKRAFKV 153

Query: 159 WQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGG 218
           W +VTPL F  +            DI I F +  HGD  PFDG  G LAHA+ PGP  GG
Sbjct: 154 WSDVTPLNFTRIR-------SGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPDYGG 312

Query: 219 DTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKL 278
           D HFD DE W+    +  G +LFLVA HE GH+LGLEHS DP A+M P Y Y     F L
Sbjct: 313 DAHFDDDETWS---DDSRGYNLFLVAAHEFGHSLGLEHSRDPGALMFPIYTYTGKSGFVL 483

Query: 279 PNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYP 338
           P+DD+QGIQ++YG                  R   P                      +P
Sbjct: 484 PDDDVQGIQELYG---------------AGDRDPNP---------------------KHP 555

Query: 339 GAKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDA 396
              P  C  D + + +  LR EM VFKD++FWR+ + ++++   + I  FW  LP  IDA
Sbjct: 556 -KTPEKCAADLSIDAITKLRGEMLVFKDRFFWRL-HPQMVEAELVLIKSFWPELPNKIDA 729

Query: 397 VYENSEGNFVF-FKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYF 455
            YEN   + VF FK  K W      +  G+P  +  +G       ID+ +  +D GKT F
Sbjct: 730 AYENPIKDLVFMFKGKKVWAMNGYDIVEGFPKKIYEMGFPKEMKKIDAVVHIDDTGKTLF 909

Query: 456 FKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYF 503
           F G++YW Y EE   MD GYPK I   + GI +      V+  NG+ YF
Sbjct: 910 FTGNKYWSYDEETEVMDTGYPKFIEDEFAGIGDRVDA--VYHRNGYLYF 1050
>ref|NM_022122.1| Homo sapiens matrix metalloproteinase 27 (MMP27), mRNA
          Length = 1655

 Score =  246 bits (628), Expect = 5e-63
 Identities = 161/465 (34%), Positives = 222/465 (47%), Gaps = 11/465 (2%)
 Frame = +1

Query: 64  RSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT 123
           ++   +   I  MQ F+G+ +TGK+D NT++ MK PRCGVPD         + +  Y L 
Sbjct: 166 KNRSLIDDKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPD---------VGQYGYTLP 318

Query: 124 GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVD 183
           G  W+  ++ Y I N TP +  A   +AI+   +VW  VTPL F ++        K   D
Sbjct: 319 G--WRKYNLTYRIINYTPDMARAAVDEAIQEGLEVWSKVTPLKFTKI-------SKGIAD 471

Query: 184 ITIIFASGFHGDSSP-FDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFL 242
           I I F +  HG     FDG  G L HA+ PGPG+GGDTHFD DE WT       G +LFL
Sbjct: 472 IMIAFRTRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGA---GFNLFL 642

Query: 243 VAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXX 302
           VA HE GHALGL HSND TA+M P Y  ++   + L  DD+ GIQ IYG           
Sbjct: 643 VAAHEFGHALGLSHSNDQTALMFPNYVSLDPRKYPLSQDDINGIQSIYGGLPK------- 801

Query: 303 XXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMF 360
                      PA                          P+ CD +  F+ +   RRE+ 
Sbjct: 802 ----------EPAKPKEPTI-------------------PHACDPDLTFDAITTFRREVM 894

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
            FK +  WR+  + + D     I  FW  LP  + A YEN     + FK   FW+ +   
Sbjct: 895 FFKGRHLWRIYYD-ITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYA 1071

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP-KPI 479
           + P YP  + TLG       ID+A+  +   KTYFF G   WR+ E  ++MD G+P + +
Sbjct: 1072VLPDYPKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVV 1251

Query: 480 TIWKGIPESPQGAFVHKENGFTYFIK-------EKSTGNSTKMLR 517
             + GI      AF +K  GF +F +       +  T N T+++R
Sbjct: 1252KHFPGISIRVDAAFQYK--GFFFFSRGSKQFEYDIKTKNITRIMR 1380
>gb|AF195192.1|AF195192 Homo sapiens matrix metalloprotease MMP-27 mRNA, complete cds
          Length = 1655

 Score =  246 bits (628), Expect = 5e-63
 Identities = 161/465 (34%), Positives = 222/465 (47%), Gaps = 11/465 (2%)
 Frame = +1

Query: 64  RSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT 123
           ++   +   I  MQ F+G+ +TGK+D NT++ MK PRCGVPD         + +  Y L 
Sbjct: 166 KNRSLIDDKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPD---------VGQYGYTLP 318

Query: 124 GQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVD 183
           G  W+  ++ Y I N TP +  A   +AI+   +VW  VTPL F ++        K   D
Sbjct: 319 G--WRKYNLTYRIINYTPDMARAAVDEAIQEGLEVWSKVTPLKFTKI-------SKGIAD 471

Query: 184 ITIIFASGFHGDSSP-FDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFL 242
           I I F +  HG     FDG  G L HA+ PGPG+GGDTHFD DE WT       G +LFL
Sbjct: 472 IMIAFRTRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGA---GFNLFL 642

Query: 243 VAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXX 302
           VA HE GHALGL HSND TA+M P Y  ++   + L  DD+ GIQ IYG           
Sbjct: 643 VAAHEFGHALGLSHSNDQTALMFPNYVSLDPRKYPLSQDDINGIQSIYGGLPK------- 801

Query: 303 XXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGN--FNTLVILRREMF 360
                      PA                          P+ CD +  F+ +   RRE+ 
Sbjct: 802 ----------EPAKPKEPTI-------------------PHACDPDLTFDAITTFRREVM 894

Query: 361 VFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTT 420
            FK +  WR+  + + D     I  FW  LP  + A YEN     + FK   FW+ +   
Sbjct: 895 FFKGRHLWRIYYD-ITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYA 1071

Query: 421 LQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP-KPI 479
           + P YP  + TLG       ID+A+  +   KTYFF G   WR+ E  ++MD G+P + +
Sbjct: 1072VLPDYPKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVV 1251

Query: 480 TIWKGIPESPQGAFVHKENGFTYFIK-------EKSTGNSTKMLR 517
             + GI      AF +K  GF +F +       +  T N T+++R
Sbjct: 1252KHFPGISIRVDAAFQYK--GFFFFSRGSKQFEYDIKTKNITRIMR 1380
>ref|NM_032007.1| Mus musculus collagenase-like B (Mcolb-pending), mRNA
          Length = 1400

 Score =  237 bits (605), Expect = 2e-60
 Identities = 156/443 (35%), Positives = 212/443 (47%), Gaps = 6/443 (1%)
 Frame = +1

Query: 67  ETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT--G 124
           E M   +  MQQ +G+ +TG  D  T+  MKKPRCGVPD              YA+T   
Sbjct: 166 EVMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAP-----------YAITHNN 312

Query: 125 QKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDI 184
            +W   H+ YSI N TP +  A    AI RAF VW +VTPLTF+ V        + + DI
Sbjct: 313 PRWTKTHLTYSILNYTPYLSKAVVEDAIARAFRVWSDVTPLTFQRV-------FEEEGDI 471

Query: 185 TIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVA 244
            + F  G HGD   FDG     AHA+ PG G+GG+ H+D D+ WT    N++  +LF V 
Sbjct: 472 VLSFHRGDHGDLYTFDGSKYHFAHAFLPGLGLGGNVHYDLDQKWT---DNNEDFNLFYVT 642

Query: 245 VHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXX 304
            HELGH+LGL HSND  A+M P Y +   D F L  DD+  IQ +YG             
Sbjct: 643 AHELGHSLGLSHSNDEEALMFPSYTWSNKD-FVLNQDDINRIQALYGPSPNPIQLTDA-- 813

Query: 305 XXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKD 364
                 ++ P                                  F+ ++  R E+  FKD
Sbjct: 814 ------TLDPCNSGL----------------------------TFDAIITYRGEVIFFKD 891

Query: 365 QWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQP 423
           +++ RV  + + +     I   W  LP   DA YE +      FFK +K W  ++  +  
Sbjct: 892 RFYIRV-ISFLPEPLIDVIDLTWPNLPGKFDAAYEVSGVDELRFFKGSKVWAVQEQNVLE 1068

Query: 424 GYPHDLITLGSGIPSH--GIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT- 480
           G+P D+ +   G PS+   ID+A+  E+ GKTYFF    YWRY E  RSMDPGYP+ I  
Sbjct: 1069GFPMDIQSF-FGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSMDPGYPRLIAE 1245

Query: 481 IWKGIPESPQGAFVHKENGFTYF 503
            + GI        + KE+ F +F
Sbjct: 1246DFPGIDYKVDDV-IQKEDNFYFF 1311
 Score = 48.1 bits (113), Expect = 0.002
 Identities = 46/160 (28%), Positives = 70/160 (43%), Gaps = 4/160 (2%)
 Frame = +1

Query: 403  GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
            G  +FFK ++F++ +  +  P    D+I L         D+A     V +  FFKG + W
Sbjct: 868  GEVIFFK-DRFYI-RVISFLPEPLIDVIDLTWPNLPGKFDAAYEVSGVDELRFFKGSKVW 1041

Query: 463  RYGEEMRSMDPGYPKPITIWKGIPESP---QGAFVHKENGFTYFIKEKSTGNSTKMLR-V 518
               E+  ++  G+P  I  + G P +      A   +E G TYF  +       +  R +
Sbjct: 1042 AVQEQ--NVLEGFPMDIQSFFGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSM 1215

Query: 519  EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDN 558
            +PGYPR I +DF G D   D            D+I K DN
Sbjct: 1216 DPGYPRLIAEDFPGIDYKVD------------DVIQKEDN 1299
>emb|AJ278461.1|MMU278461 Mus musculus mRNA for putative matrix metalloproteinase (McolB
           gene)
          Length = 1400

 Score =  237 bits (605), Expect = 2e-60
 Identities = 156/443 (35%), Positives = 212/443 (47%), Gaps = 6/443 (1%)
 Frame = +1

Query: 67  ETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT--G 124
           E M   +  MQQ +G+ +TG  D  T+  MKKPRCGVPD              YA+T   
Sbjct: 166 EVMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAP-----------YAITHNN 312

Query: 125 QKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDI 184
            +W   H+ YSI N TP +  A    AI RAF VW +VTPLTF+ V        + + DI
Sbjct: 313 PRWTKTHLTYSILNYTPYLSKAVVEDAIARAFRVWSDVTPLTFQRV-------FEEEGDI 471

Query: 185 TIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVA 244
            + F  G HGD   FDG     AHA+ PG G+GG+ H+D D+ WT    N++  +LF V 
Sbjct: 472 VLSFHRGDHGDLYTFDGSKYHFAHAFLPGLGLGGNVHYDLDQKWT---DNNEDFNLFYVT 642

Query: 245 VHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXX 304
            HELGH+LGL HSND  A+M P Y +   D F L  DD+  IQ +YG             
Sbjct: 643 AHELGHSLGLSHSNDEEALMFPSYTWSNKD-FVLNQDDINRIQALYGPSPNPIQLTDA-- 813

Query: 305 XXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREMFVFKD 364
                 ++ P                                  F+ ++  R E+  FKD
Sbjct: 814 ------TLDPCNSGL----------------------------TFDAIITYRGEVIFFKD 891

Query: 365 QWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NSEGNFVFFKSNKFWVFKDTTLQP 423
           +++ RV  + + +     I   W  LP   DA YE +      FFK +K W  ++  +  
Sbjct: 892 RFYIRV-ISFLPEPLIDVIDLTWPNLPGKFDAAYEVSGVDELRFFKGSKVWAVQEQNVLE 1068

Query: 424 GYPHDLITLGSGIPSH--GIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPIT- 480
           G+P D+ +   G PS+   ID+A+  E+ GKTYFF    YWRY E  RSMDPGYP+ I  
Sbjct: 1069GFPMDIQSF-FGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSMDPGYPRLIAE 1245

Query: 481 IWKGIPESPQGAFVHKENGFTYF 503
            + GI        + KE+ F +F
Sbjct: 1246DFPGIDYKVDDV-IQKEDNFYFF 1311
 Score = 48.1 bits (113), Expect = 0.002
 Identities = 46/160 (28%), Positives = 70/160 (43%), Gaps = 4/160 (2%)
 Frame = +1

Query: 403  GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
            G  +FFK ++F++ +  +  P    D+I L         D+A     V +  FFKG + W
Sbjct: 868  GEVIFFK-DRFYI-RVISFLPEPLIDVIDLTWPNLPGKFDAAYEVSGVDELRFFKGSKVW 1041

Query: 463  RYGEEMRSMDPGYPKPITIWKGIPESP---QGAFVHKENGFTYFIKEKSTGNSTKMLR-V 518
               E+  ++  G+P  I  + G P +      A   +E G TYF  +       +  R +
Sbjct: 1042 AVQEQ--NVLEGFPMDIQSFFGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSM 1215

Query: 519  EPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDN 558
            +PGYPR I +DF G D   D            D+I K DN
Sbjct: 1216 DPGYPRLIAEDFPGIDYKVD------------DVIQKEDN 1299
>gb|U37791.1|HSU37791 Homo sapiens clone rasi-1 matrix metalloproteinase RASI-1 mRNA,
           complete cds
          Length = 3222

 Score =  224 bits (570), Expect = 3e-56
 Identities = 156/496 (31%), Positives = 242/496 (48%), Gaps = 8/496 (1%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL       +  +  E +  A+ A Q+   + ++G++D  T   M++PRCG+ D
Sbjct: 172 YLSQYGYLQKPLEGSNNFKP-EDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLED 348

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G +W+ KH+ + I N+   +     R A+R+AF  W NV PL
Sbjct: 349 P------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPL 507

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF+EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P     G  
Sbjct: 508 TFQEV-----QAGAADIRLS------FHGRQSSYCSNTFDGPGRVLAHADIPEL---GSV 645

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y+     +FKL  
Sbjct: 646 HFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYR-PHFKLHP 816

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++PP                     + P  
Sbjct: 817 DDVAGIQALYGKKSPVIRDEEEEETEL--PTVPPV-------------------PTEPSP 933

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
            P+ C    + +++  R + + FK  + W V ++    G   +++  W GLP ++DA   
Sbjct: 934 MPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVY 1107

Query: 400 NSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           +    ++ FFK +K W + +  + PG+P  L  +        +D+A++W    K + FKG
Sbjct: 1108SPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRV-----EPNLDAALYWPLNQKVFLFKG 1272

Query: 459 DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P  P  A +  ++G  YF K K      + LR
Sbjct: 1273SGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLR 1449

Query: 518 VEPGYPRSILKDFMGC 533
           VE GYPR+I  ++M C
Sbjct: 1450VEKGYPRNISHNWMHC 1497
>ref|NM_002429.2| Homo sapiens matrix metalloproteinase 19 (MMP19), transcript
           variant rasi-1, mRNA
          Length = 3249

 Score =  224 bits (570), Expect = 3e-56
 Identities = 156/496 (31%), Positives = 242/496 (48%), Gaps = 8/496 (1%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL       +  +  E +  A+ A Q+   + ++G++D  T   M++PRCG+ D
Sbjct: 199 YLSQYGYLQKPLEGSNNFKP-EDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLED 375

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G +W+ KH+ + I N+   +     R A+R+AF  W NV PL
Sbjct: 376 P------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPL 534

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF+EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P     G  
Sbjct: 535 TFQEV-----QAGAADIRLS------FHGRQSSYCSNTFDGPGRVLAHADIPEL---GSV 672

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y+     +FKL  
Sbjct: 673 HFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYR-PHFKLHP 843

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++PP                     + P  
Sbjct: 844 DDVAGIQALYGKKSPVIRDEEEEETEL--PTVPPV-------------------PTEPSP 960

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
            P+ C    + +++  R + + FK  + W V ++    G   +++  W GLP ++DA   
Sbjct: 961 MPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVY 1134

Query: 400 NSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           +    ++ FFK +K W + +  + PG+P  L  +        +D+A++W    K + FKG
Sbjct: 1135SPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRV-----EPNLDAALYWPLNQKVFLFKG 1299

Query: 459 DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P  P  A +  ++G  YF K K      + LR
Sbjct: 1300SGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLR 1476

Query: 518 VEPGYPRSILKDFMGC 533
           VE GYPR+I  ++M C
Sbjct: 1477VEKGYPRNISHNWMHC 1524
>emb|X92521.1|HSMMP19 H.sapiens mRNA for MMP-19 protein
          Length = 1811

 Score =  224 bits (570), Expect = 3e-56
 Identities = 156/496 (31%), Positives = 242/496 (48%), Gaps = 8/496 (1%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL       +  +  E +  A+ A Q+   + ++G++D  T   M++PRCG+ D
Sbjct: 192 YLSQYGYLQKPLEGSNNFKP-EDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLED 368

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G +W+ KH+ + I N+   +     R A+R+AF  W NV PL
Sbjct: 369 P------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPL 527

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF+EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P     G  
Sbjct: 528 TFQEV-----QAGAADIRLS------FHGRQSSYCSNTFDGPGRVLAHADIPEL---GSV 665

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y+     +FKL  
Sbjct: 666 HFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYR-PHFKLHP 836

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++PP                     + P  
Sbjct: 837 DDVAGIQALYGKKSPVIRDEEEEETEL--PTVPPV-------------------PTEPSP 953

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
            P+ C    + +++  R + + FK  + W V ++    G   +++  W GLP ++DA   
Sbjct: 954 MPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVY 1127

Query: 400 NSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           +    ++ FFK +K W + +  + PG+P  L  +        +D+A++W    K + FKG
Sbjct: 1128SPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRV-----EPNLDAALYWPLNQKVFLFKG 1292

Query: 459 DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P  P  A +  ++G  YF K K      + LR
Sbjct: 1293SGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLR 1469

Query: 518 VEPGYPRSILKDFMGC 533
           VE GYPR+I  ++M C
Sbjct: 1470VEKGYPRNISHNWMHC 1517
>gb|U38321.1|HSU38321 Homo sapiens clone rasi-11 matrix metalloproteinase RASI-1 mRNA,
           complete cds
          Length = 2231

 Score =  224 bits (570), Expect = 3e-56
 Identities = 156/496 (31%), Positives = 242/496 (48%), Gaps = 8/496 (1%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL       +  +  E +  A+ A Q+   + ++G++D  T   M++PRCG+ D
Sbjct: 167 YLSQYGYLQKPLEGSNNFKP-EDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLED 343

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G +W+ KH+ + I N+   +     R A+R+AF  W NV PL
Sbjct: 344 P------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPL 502

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF+EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P     G  
Sbjct: 503 TFQEV-----QAGAADIRLS------FHGRQSSYCSNTFDGPGRVLAHADIPEL---GSV 640

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y+     +FKL  
Sbjct: 641 HFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYR-PHFKLHP 811

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++PP                     + P  
Sbjct: 812 DDVAGIQALYGKKSPVIRDEEEEETEL--PTVPPV-------------------PTEPSP 928

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
            P+ C    + +++  R + + FK  + W V ++    G   +++  W GLP ++DA   
Sbjct: 929 MPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVY 1102

Query: 400 NSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           +    ++ FFK +K W + +  + PG+P  L  +        +D+A++W    K + FKG
Sbjct: 1103SPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRV-----EPNLDAALYWPLNQKVFLFKG 1267

Query: 459 DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P  P  A +  ++G  YF K K      + LR
Sbjct: 1268SGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLR 1444

Query: 518 VEPGYPRSILKDFMGC 533
           VE GYPR+I  ++M C
Sbjct: 1445VEKGYPRNISHNWMHC 1492
>emb|Y08622.1|HSRMMP18 H.sapiens mRNA for matrix metalloproteinase MMP-18
          Length = 2248

 Score =  223 bits (569), Expect = 3e-56
 Identities = 156/496 (31%), Positives = 241/496 (48%), Gaps = 8/496 (1%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL       +  +  E +  A+ A Q+   + ++G++D  T   M++PRCG+ D
Sbjct: 191 YLSQYGYLQKPLEGSNNFKP-EDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLED 367

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G +W+ KH+ + I N+   +     R A+R+AF  W NV PL
Sbjct: 368 P------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPL 526

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF+EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P     G  
Sbjct: 527 TFQEV-----QAGAADIRLS------FHGRQSSYCSNTFDGPGRVLAHADIPEL---GSV 664

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y+     +FKL  
Sbjct: 665 HFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYR-PHFKLHP 835

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++PP                     + P  
Sbjct: 836 DDVAGIQALYGKKSPVIRDEEEEETEL--PTVPPV-------------------PTEPSP 952

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
            P+ C    + +++  R + + FK  + W V ++    G   +++  W GLP ++DA   
Sbjct: 953 MPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVY 1126

Query: 400 NSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
           +    ++ FFK +K W + +  + PG+P  L           +D+A++W    K + FKG
Sbjct: 1127SPRTQWIHFFKGDKVWRYINFKMSPGFPKKL-----NRSEPNLDAALYWPLNQKVFLFKG 1291

Query: 459 DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P  P  A +  ++G  YF K K      + LR
Sbjct: 1292SGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLR 1468

Query: 518 VEPGYPRSILKDFMGC 533
           VE GYPR+I  ++M C
Sbjct: 1469VEKGYPRNISHNWMHC 1516
>gb|AC090980.5| Homo sapiens chromosome 8, clone RP11-433O22, complete sequence
          Length = 182881

 Score =  223 bits (568), Expect = 4e-56
 Identities = 102/112 (91%), Positives = 107/112 (95%)
 Frame = -1

Query: 132   IAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASG 191
             + +SIKNVTPKVGD ETRKAIRRAFDVWQNVTPLTFEEVPY ELENGKRDVDITIIFASG
Sbjct: 31276 LTFSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASG 31097

Query: 192   FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLV 243
             FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG  +F++
Sbjct: 31096 FHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGKYMFVL 30941
 Score =  107 bits (266), Expect = 4e-21
 Identities = 58/93 (62%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = -1

Query: 40    YFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKP 99
             Y  ++VWLQKYGYLPPTDPRMSVLRSAETMQSA+AAMQQFYGINMTGKVDRNTI+ +  P
Sbjct: 60613 YLLLQVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIE*VMAP 60434

Query: 100   ---RCGVPDQTRGSSKFNIRRKRYALTGQKWQH 129
                      QT+ S K  +       T QKW +
Sbjct: 60433 ILLSFWSLSQTK*SGKLYMNS-----TNQKWSN 60350
 Score = 92.4 bits (228), Expect = 1e-16
 Identities = 40/44 (90%), Positives = 41/44 (92%)
 Frame = -3

Query: 95    WMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKN 138
             WMKKPRCGVPDQTRGSSKF+IRRKRYALTGQKWQHKHI Y  KN
Sbjct: 49889 WMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYRYKN 49758
>ref|NM_021412.1| Mus musculus matrix metalloproteinase 19 (Mmp19), mRNA
          Length = 2132

 Score =  221 bits (564), Expect = 1e-55
 Identities = 167/513 (32%), Positives = 240/513 (46%), Gaps = 8/513 (1%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL          R  E +  A+   Q+  G+ ++G++D  T   MK+PRCG+ D
Sbjct: 176 YLLQYGYLQKPLEGADDFR-LEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLED 352

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G  W+ K++ + I NV   +     R A+ +AF  W +V PL
Sbjct: 353 P------FNQKSLKYLLLGH-WRKKNLTFRIFNVPSTLSLPRVRAALHQAFKYWSSVAPL 511

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P  G     
Sbjct: 512 TFREV-----KAGWADIRLS------FHGRQSLYCSNTFDGPGKVLAHADIPELG---SI 649

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y   +   FKL  
Sbjct: 650 HFDKDELWTEGT--YQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQ-PFFKLHP 820

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++ P                     + PG 
Sbjct: 821 DDVAGIQALYGKRSPETRDEEEETEML---TVSPV-------------------TAKPGP 934

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID-AVY 398
            PN C G  + +V+  R + + FK  + W V ++    G   QI+  W GLP ++D AVY
Sbjct: 935 MPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSG--PGPLFQISALWEGLPGNLDAAVY 1108

Query: 399 ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
                   FFK NK W + D  + PG+P     +        +D+A++W    K + FKG
Sbjct: 1109SPRTRRTHFFKGNKVWRYVDFKMSPGFPMKFNRV-----EPNLDAALYWPVNQKVFLFKG 1273

Query: 459 DRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P+ P  A +  ++G  YF K K      + LR
Sbjct: 1274SGYWQWDELARTDLSRYPKPIKELFTGVPDRPSAA-MSWQDGQVYFFKGKEYWRLNQQLR 1450

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDV 550
           V  GYPR+    +M C   T    D +S   DV
Sbjct: 1451VAKGYPRN-TTHWMHCGSQT---PDTNSSTGDV 1537
>gb|AF155221.1|AF155221 Mus musculus matrix metalloproteinase 19 (Mmp19) mRNA, complete cds
          Length = 2132

 Score =  221 bits (564), Expect = 1e-55
 Identities = 167/513 (32%), Positives = 240/513 (46%), Gaps = 8/513 (1%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL          R  E +  A+   Q+  G+ ++G++D  T   MK+PRCG+ D
Sbjct: 176 YLLQYGYLQKPLEGADDFR-LEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLED 352

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G  W+ K++ + I NV   +     R A+ +AF  W +V PL
Sbjct: 353 P------FNQKSLKYLLLGH-WRKKNLTFRIFNVPSTLSLPRVRAALHQAFKYWSSVAPL 511

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P  G     
Sbjct: 512 TFREV-----KAGWADIRLS------FHGRQSLYCSNTFDGPGKVLAHADIPELG---SI 649

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y   +   FKL  
Sbjct: 650 HFDKDELWTEGT--YQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQ-PFFKLHP 820

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++ P                     + PG 
Sbjct: 821 DDVAGIQALYGKRSPETRDEEEETEML---TVSPV-------------------TAKPGP 934

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID-AVY 398
            PN C G  + +V+  R + + FK  + W V ++    G   QI+  W GLP ++D AVY
Sbjct: 935 MPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSG--PGPLFQISALWEGLPGNLDAAVY 1108

Query: 399 ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
                   FFK NK W + D  + PG+P     +        +D+A++W    K + FKG
Sbjct: 1109SPRTRRTHFFKGNKVWRYVDFKMSPGFPMKFNRV-----EPNLDAALYWPVNQKVFLFKG 1273

Query: 459 DRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P+ P  A +  ++G  YF K K      + LR
Sbjct: 1274SGYWQWDELARTDLSRYPKPIKELFTGVPDRPSAA-MSWQDGQVYFFKGKEYWRLNQQLR 1450

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDV 550
           V  GYPR+    +M C   T    D +S   DV
Sbjct: 1451VAKGYPRN-TTHWMHCGSQT---PDTNSSTGDV 1537
>gb|AF162446.1|AF162446 Mus musculus matrix metalloproteinase-19 mRNA, complete cds
          Length = 1862

 Score =  221 bits (564), Expect = 1e-55
 Identities = 167/513 (32%), Positives = 240/513 (46%), Gaps = 8/513 (1%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL          R  E +  A+   Q+  G+ ++G++D  T   MK+PRCG+ D
Sbjct: 176 YLLQYGYLQKPLEGADDFR-LEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLED 352

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G  W+ K++ + I NV   +     R A+ +AF  W +V PL
Sbjct: 353 P------FNQKSLKYLLLGH-WRKKNLTFRIFNVPSTLSLPRVRAALHQAFKYWSSVAPL 511

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P  G     
Sbjct: 512 TFREV-----KAGWADIRLS------FHGRQSLYCSNTFDGPGKVLAHADIPELG---SI 649

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y   +   FKL  
Sbjct: 650 HFDKDELWTEGT--YQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQ-PFFKLHP 820

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++ P                     + PG 
Sbjct: 821 DDVAGIQALYGKRSPETRDEEEETEML---TVSPV-------------------TAKPGP 934

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID-AVY 398
            PN C G  + +V+  R + + FK  + W V ++    G   QI+  W GLP ++D AVY
Sbjct: 935 MPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSG--PGPLFQISALWEGLPGNLDAAVY 1108

Query: 399 ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
                   FFK NK W + D  + PG+P     +        +D+A++W    K + FKG
Sbjct: 1109SPRTRRTHFFKGNKVWRYVDFKMSPGFPMKFNRV-----EPNLDAALYWPVNQKVFLFKG 1273

Query: 459 DRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P+ P  A +  ++G  YF K K      + LR
Sbjct: 1274SGYWQWDELARTDLSRYPKPIKELFTGVPDRPSAA-MSWQDGQVYFFKGKEYWRLNQQLR 1450

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDV 550
           V  GYPR+    +M C   T    D +S   DV
Sbjct: 1451VAKGYPRN-TTHWMHCGSQT---PDTNSSTGDV 1537
>gb|AF153199.1|AF153199 Mus musculus matrix metalloproteinase 19 mRNA, complete cds
          Length = 1703

 Score =  221 bits (564), Expect = 1e-55
 Identities = 167/513 (32%), Positives = 240/513 (46%), Gaps = 8/513 (1%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L +YGYL          R  E +  A+   Q+  G+ ++G++D  T   MK+PRCG+ D
Sbjct: 148 YLLQYGYLQKPLEGADDFR-LEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLED 324

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                  FN +  +Y L G  W+ K++ + I NV   +     R A+ +AF  W +V PL
Sbjct: 325 P------FNQKSLKYLLLGH-WRKKNLTFRIFNVPSTLSLPRVRAALHQAFKYWSSVAPL 483

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGD-----SSPFDGEGGFLAHAYFPGPGIGGDT 220
           TF EV     + G  D+ ++      FHG      S+ FDG G  LAHA  P  G     
Sbjct: 484 TFREV-----KAGWADIRLS------FHGRQSLYCSNTFDGPGKVLAHADIPELG---SI 621

Query: 221 HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
           HFD DE WT G   + G +L ++A HE+GHALGL HS    A+MAP Y   +   FKL  
Sbjct: 622 HFDKDELWTEGT--YQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQ-PFFKLHP 792

Query: 281 DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
           DD+ GIQ +YG                   ++ P                     + PG 
Sbjct: 793 DDVAGIQALYGKRSPETRDEEEETEML---TVSPV-------------------TAKPGP 906

Query: 341 KPNICDGNFNTLVI-LRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSID-AVY 398
            PN C G  + +V+  R + + FK  + W V ++    G   QI+  W GLP ++D AVY
Sbjct: 907 MPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSG--PGPLFQISALWEGLPGNLDAAVY 1080

Query: 399 ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
                   FFK NK W + D  + PG+P     +        +D+A++W    K + FKG
Sbjct: 1081SPRTRRTHFFKGNKVWRYVDFKMSPGFPMKFNRV-----EPNLDAALYWPVNQKVFLFKG 1245

Query: 459 DRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLR 517
             YW++ E  R+    YPKPI  ++ G+P+ P  A +  ++G  YF K K      + LR
Sbjct: 1246SGYWQWDELARTDLSRYPKPIKELFTGVPDRPSAA-MSWQDGQVYFFKGKEYWRLNQQLR 1422

Query: 518 VEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDV 550
           V  GYPR+    +M C   T    D +S   DV
Sbjct: 1423VAKGYPRN-TTHWMHCGSQT---PDTNSSTGDV 1509
>gb|AF315683.1|AF315683 Homo sapiens matrix metalloproteinase 28 (MMP28) mRNA, complete cds
          Length = 1753

 Score =  215 bits (547), Expect = 1e-53
 Identities = 150/486 (30%), Positives = 224/486 (45%), Gaps = 26/486 (5%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV
Sbjct: 124 EAFLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGV 294

Query: 104 PDQT--------------RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETR 149
            D                R  +K   R+KR+A  G KW  +H++Y + N    + +   R
Sbjct: 295 TDTNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVR 471

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD--SSPFDGEGGFLA 207
            A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG LA
Sbjct: 472 GAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGALA 633

Query: 208 HAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPF 267
           HA+ P     G+ HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP+
Sbjct: 634 HAFLPR---RGEAHFDQDERWSLS--RRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPY 798

Query: 268 YQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXX 327
           Y+ +  D   L  DD+  +Q +YG                      P             
Sbjct: 799 YKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGKL 912

Query: 328 XXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMDG 378
                   SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V + 
Sbjct: 913 FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEP 1092

Query: 379 YPMQITYFWRGLPPSIDAVYEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIP 437
            P+Q    W GLPP+I+A   + ++G+F FFK  + W F+      G P   +    G+P
Sbjct: 1093RPLQER--WVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQ--LCRAGGLP 1260

Query: 438 SHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE 497
            H  D+A+++  + +   FKG RY+        ++P YP+ +  W GIPE   GA    +
Sbjct: 1261RHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPD 1437

Query: 498 NGFTYF 503
               +F
Sbjct: 1438GSIIFF 1455
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 44/149 (29%), Positives = 63/149 (41%), Gaps = 9/149 (6%)
 Frame = +1

Query: 393  SIDAVYENSEGNFVFFKSNKFW-VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVG 451
            S DA+  + +     FK + FW V  D  +    P  L     G+P +   +A+   D G
Sbjct: 994  SFDAITVDRQQQLYIFKGSHFWEVAADGNVSE--PRPLQERWVGLPPNIEAAAVSLND-G 1164

Query: 452  KTYFFKGDRYWRYGEEMRSMDPGYPKP-ITIWKGIPESPQGAFVHKE-------NGFTYF 503
              YFFKG R WR+    R   P +  P +    G+P  P  A             G  Y+
Sbjct: 1165 DFYFFKGGRCWRF----RGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYY 1332

Query: 504  IKEKSTGNSTKMLRVEPGYPRSILKDFMG 532
            +  +        L+VEP YPRS L+D+ G
Sbjct: 1333 VLARGG------LQVEPYYPRS-LQDWGG 1398
>ref|NM_024302.2| Homo sapiens matrix metalloproteinase 28 (MMP28), transcript
           variant 1, mRNA
          Length = 2481

 Score =  215 bits (547), Expect = 1e-53
 Identities = 150/486 (30%), Positives = 224/486 (45%), Gaps = 26/486 (5%)
 Frame = +3

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV
Sbjct: 384 EAFLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGV 554

Query: 104 PDQT--------------RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETR 149
            D                R  +K   R+KR+A  G KW  +H++Y + N    + +   R
Sbjct: 555 TDTNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVR 731

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD--SSPFDGEGGFLA 207
            A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG LA
Sbjct: 732 GAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGALA 893

Query: 208 HAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPF 267
           HA+ P     G+ HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP+
Sbjct: 894 HAFLPR---RGEAHFDQDERWSLS--RRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPY 1058

Query: 268 YQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXX 327
           Y+ +  D   L  DD+  +Q +YG                      P             
Sbjct: 1059YKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGKL 1172

Query: 328 XXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMDG 378
                   SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V + 
Sbjct: 1173FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEP 1352

Query: 379 YPMQITYFWRGLPPSIDAVYEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIP 437
            P+Q    W GLPP+I+A   + ++G+F FFK  + W F+      G P   +    G+P
Sbjct: 1353RPLQER--WVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQ--LCRAGGLP 1520

Query: 438 SHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE 497
            H  D+A+++  + +   FKG RY+        ++P YP+ +  W GIPE   GA    +
Sbjct: 1521RHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPD 1697

Query: 498 NGFTYF 503
               +F
Sbjct: 1698GSIIFF 1715
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 44/149 (29%), Positives = 63/149 (41%), Gaps = 9/149 (6%)
 Frame = +3

Query: 393  SIDAVYENSEGNFVFFKSNKFW-VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVG 451
            S DA+  + +     FK + FW V  D  +    P  L     G+P +   +A+   D G
Sbjct: 1254 SFDAITVDRQQQLYIFKGSHFWEVAADGNVSE--PRPLQERWVGLPPNIEAAAVSLND-G 1424

Query: 452  KTYFFKGDRYWRYGEEMRSMDPGYPKP-ITIWKGIPESPQGAFVHKE-------NGFTYF 503
              YFFKG R WR+    R   P +  P +    G+P  P  A             G  Y+
Sbjct: 1425 DFYFFKGGRCWRF----RGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYY 1592

Query: 504  IKEKSTGNSTKMLRVEPGYPRSILKDFMG 532
            +  +        L+VEP YPRS L+D+ G
Sbjct: 1593 VLARGG------LQVEPYYPRS-LQDWGG 1658
>gb|AF219624.1|AF219624 Homo sapiens matrix metalloproteinase-28 precursor, mRNA, complete
           cds
          Length = 1817

 Score =  215 bits (547), Expect = 1e-53
 Identities = 150/486 (30%), Positives = 224/486 (45%), Gaps = 26/486 (5%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV
Sbjct: 278 EAFLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGV 448

Query: 104 PDQT--------------RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETR 149
            D                R  +K   R+KR+A  G KW  +H++Y + N    + +   R
Sbjct: 449 TDTNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVR 625

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD--SSPFDGEGGFLA 207
            A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG LA
Sbjct: 626 GAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGALA 787

Query: 208 HAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPF 267
           HA+ P     G+ HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP+
Sbjct: 788 HAFLPR---RGEAHFDQDERWSLS--RRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPY 952

Query: 268 YQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXX 327
           Y+ +  D   L  DD+  +Q +YG                      P             
Sbjct: 953 YKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGKL 1066

Query: 328 XXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMDG 378
                   SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V + 
Sbjct: 1067FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEP 1246

Query: 379 YPMQITYFWRGLPPSIDAVYEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIP 437
            P+Q    W GLPP+I+A   + ++G+F FFK  + W F+      G P   +    G+P
Sbjct: 1247RPLQER--WVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQ--LCRAGGLP 1414

Query: 438 SHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE 497
            H  D+A+++  + +   FKG RY+        ++P YP+ +  W GIPE   GA    +
Sbjct: 1415RHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPD 1591

Query: 498 NGFTYF 503
               +F
Sbjct: 1592GSIIFF 1609
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 44/149 (29%), Positives = 63/149 (41%), Gaps = 9/149 (6%)
 Frame = +2

Query: 393  SIDAVYENSEGNFVFFKSNKFW-VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVG 451
            S DA+  + +     FK + FW V  D  +    P  L     G+P +   +A+   D G
Sbjct: 1148 SFDAITVDRQQQLYIFKGSHFWEVAADGNVSE--PRPLQERWVGLPPNIEAAAVSLND-G 1318

Query: 452  KTYFFKGDRYWRYGEEMRSMDPGYPKP-ITIWKGIPESPQGAFVHKE-------NGFTYF 503
              YFFKG R WR+    R   P +  P +    G+P  P  A             G  Y+
Sbjct: 1319 DFYFFKGGRCWRF----RGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYY 1486

Query: 504  IKEKSTGNSTKMLRVEPGYPRSILKDFMG 532
            +  +        L+VEP YPRS L+D+ G
Sbjct: 1487 VLARGG------LQVEPYYPRS-LQDWGG 1552
>gb|AF330002.1|AF330002 Homo sapiens matrix metalloprotease MMP25 mRNA, complete cds
          Length = 2484

 Score =  215 bits (547), Expect = 1e-53
 Identities = 150/486 (30%), Positives = 224/486 (45%), Gaps = 26/486 (5%)
 Frame = +3

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV
Sbjct: 384 EAFLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGV 554

Query: 104 PDQT--------------RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETR 149
            D                R  +K   R+KR+A  G KW  +H++Y + N    + +   R
Sbjct: 555 TDTNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVR 731

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD--SSPFDGEGGFLA 207
            A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG LA
Sbjct: 732 GAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGALA 893

Query: 208 HAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPF 267
           HA+ P     G+ HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP+
Sbjct: 894 HAFLPR---RGEAHFDQDERWSLS--RRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPY 1058

Query: 268 YQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXX 327
           Y+ +  D   L  DD+  +Q +YG                      P             
Sbjct: 1059YKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGKL 1172

Query: 328 XXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMDG 378
                   SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V + 
Sbjct: 1173FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEP 1352

Query: 379 YPMQITYFWRGLPPSIDAVYEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIP 437
            P+Q    W GLPP+I+A   + ++G+F FFK  + W F+      G P   +    G+P
Sbjct: 1353RPLQER--WVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQ--LCRAGGLP 1520

Query: 438 SHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKE 497
            H  D+A+++  + +   FKG RY+        ++P YP+ +  W GIPE   GA    +
Sbjct: 1521RHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPD 1697

Query: 498 NGFTYF 503
               +F
Sbjct: 1698GSIIFF 1715
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 44/149 (29%), Positives = 63/149 (41%), Gaps = 9/149 (6%)
 Frame = +3

Query: 393  SIDAVYENSEGNFVFFKSNKFW-VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVG 451
            S DA+  + +     FK + FW V  D  +    P  L     G+P +   +A+   D G
Sbjct: 1254 SFDAITVDRQQQLYIFKGSHFWEVAADGNVSE--PRPLQERWVGLPPNIEAAAVSLND-G 1424

Query: 452  KTYFFKGDRYWRYGEEMRSMDPGYPKP-ITIWKGIPESPQGAFVHKE-------NGFTYF 503
              YFFKG R WR+    R   P +  P +    G+P  P  A             G  Y+
Sbjct: 1425 DFYFFKGGRCWRF----RGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYY 1592

Query: 504  IKEKSTGNSTKMLRVEPGYPRSILKDFMG 532
            +  +        L+VEP YPRS L+D+ G
Sbjct: 1593 VLARGG------LQVEPYYPRS-LQDWGG 1658
>gb|AF162688.1|AF162688 Hydra vulgaris matrix metalloproteinase (mmp) mRNA, complete cds
          Length = 1634

 Score =  209 bits (531), Expect = 8e-52
 Identities = 139/473 (29%), Positives = 230/473 (48%), Gaps = 9/473 (1%)
 Frame = +2

Query: 63  LRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYAL 122
           + + + ++++I  +Q+F GI ++G +D  T + ++ PRCG+PD  + +     R +RY L
Sbjct: 170 INNEKEIRNSIENLQRFAGIPVSGILDAPTQELIETPRCGLPDFKKPNES---RNRRYTL 340

Query: 123 TGQKWQHKHIAYSI-KNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRD 181
            G  W+   + + +  N    +   E    + +AF +W+ VT L F ++      N  + 
Sbjct: 341 QGTTWKKNELTWKLLNNNNDGLTRGEIETTLHKAFSMWEAVTNLKFRQLQI----NENKK 508

Query: 182 VDITIIFASGFHGDSSPFDGEGGFLAHAYFP--GPGIGGDTHFDSDEPWTLGNPNHDGND 239
            DI I FA G+H D   FDG GG LAHA++P    G+ GD HFD  E +T+ +P  +G  
Sbjct: 509 ADIEIKFAQGYHDDPYSFDGFGGTLAHAFYPHTNEGLSGDVHFDDAEKFTIESP--EGRS 682

Query: 240 LFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXX 299
           L  VAVHE+GH++GLEHSN   A+M P+Y+  +  + +L +DD+ GIQ IYG        
Sbjct: 683 LLWVAVHEIGHSIGLEHSNVKEALMFPWYRVQDVRDIQLSDDDVLGIQSIYGSKKSIMLP 862

Query: 300 XXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTLVILRREM 359
                      S                             K  I D +           
Sbjct: 863 STVTPTKKMKNSFQ--------------------------MKAVILDKSTGV-------T 943

Query: 360 FVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDT 419
           + F D  F+++ N+      P  ++  +  +  S+++ Y +S+G  +FFK  +++ +K+ 
Sbjct: 944 YAFNDDEFYKINNDLKKTEGPFTVSSLFPEV-NSVNSGYMDSDGKLIFFKGTRYYTYKNF 1120

Query: 420 T----LQPGYPHDLIT-LGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPG 474
           +    L+ G   D    + SG+ +  ID+A  W + G+TY F  D Y+R+G     +D G
Sbjct: 1121SDRKLLESGSIFDKYKGIKSGVKT--IDAAFVWNN-GRTYVFIEDEYYRFGGTKNVLDAG 1291

Query: 475 YPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYPRSI 526
           +P+ I   W G+P++    FV + NG TYF K        +  +V   YP+SI
Sbjct: 1292FPRKIVDNWTGVPKNIDSVFVWR-NGVTYFFKGSLFYRVNEKGQVLLNYPKSI 1447
>gb|AF354290.1|AF354290 Xenopus laevis matrix metalloproteinase MT3-MMP gene, partial cds
          Length = 375

 Score =  207 bits (527), Expect = 2e-51
 Identities = 103/123 (83%), Positives = 108/123 (87%), Gaps = 1/123 (0%)
 Frame = +2

Query: 487 ESPQGAFVHKENGFTYFIKEKSTGNSTKM-LRVEPGYPRSILKDFMGCDGPTDRDKDRHS 545
           ESPQGAFV KENG+TYF K K       + LRVEPGYPRSILKDFMGCD  TD DK+R S
Sbjct: 2   ESPQGAFVDKENGYTYFYKGKEYWKFQNLNLRVEPGYPRSILKDFMGCDSSTDGDKERTS 181

Query: 546 PQDDVDIIIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQ 605
           PQDDVDI+IKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKR+GTPRHILYCKRSMQ
Sbjct: 182 PQDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQ 361

Query: 606 EWV 608
           EWV
Sbjct: 362 EWV 370
>ref|NM_032950.1| Homo sapiens matrix metalloproteinase 28 (MMP28), transcript
           variant 2, mRNA
          Length = 2525

 Score =  202 bits (515), Expect = 6e-50
 Identities = 150/507 (29%), Positives = 224/507 (43%), Gaps = 47/507 (9%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV
Sbjct: 365 EAFLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGV 535

Query: 104 PDQT--------------RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETR 149
            D                R  +K   R+KR+A  G KW  +H++Y + N    + +   R
Sbjct: 536 TDTNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVR 712

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD--SSPFDGEGGFLA 207
            A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG LA
Sbjct: 713 GAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGALA 874

Query: 208 HAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPF 267
           HA+ P     G+ HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP+
Sbjct: 875 HAFLPR---RGEAHFDQDERWSLS--RRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPY 1039

Query: 268 YQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXX 327
           Y+ +  D   L  DD+  +Q +YG                      P             
Sbjct: 1040YKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGKL 1153

Query: 328 XXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMDG 378
                   SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V + 
Sbjct: 1154FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEP 1333

Query: 379 YPMQITYFWRGLPPSIDAVYEN-SEGNFVFFK---------------------SNKFWVF 416
            P+Q    W GLPP+I+A   + ++G+F FFK                       + W F
Sbjct: 1334RPLQER--WVGLPPNIEAAAVSLNDGDFYFFKVQSV*LI*IPTIVGSSLKESRGGRCWRF 1507

Query: 417 KDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP 476
           +      G P   +    G+P H  D+A+++  + +   FKG RY+        ++P YP
Sbjct: 1508RGPKPVWGLPQ--LCRAGGLPRHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYP 1678

Query: 477 KPITIWKGIPESPQGAFVHKENGFTYF 503
           + +  W GIPE   GA    +    +F
Sbjct: 1679RSLQDWGGIPEEVSGALPRPDGSIIFF 1759
 Score = 37.7 bits (86), Expect = 3.3
 Identities = 44/159 (27%), Positives = 62/159 (38%), Gaps = 3/159 (1%)
 Frame = +2

Query: 368  WRVRNNRVMDGYPMQITYFWRGLPPSIDA-VYENSEGNFVFFKSNKFWVFKDTTLQ--PG 424
            WR R  + + G P        GLP   DA ++       + FK  +++V     LQ  P 
Sbjct: 1499 WRFRGPKPVWGLPQLCRA--GGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPY 1672

Query: 425  YPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKG 484
            YP  L   G GIP   +  A+   D G   FF+ DRYWR       +D    +  T  + 
Sbjct: 1673 YPRSLQDWG-GIPEE-VSGALPRPD-GSIIFFRDDRYWR-------LDQAKLQATTSGRW 1822

Query: 485  IPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYP 523
              E P     H  +G   F +   T  +   LR +   P
Sbjct: 1823 ATELPWMGCWHANSGSALF*RHLLTSETGGALRAKSCSP 1939
>gb|BC002631.1|BC002631 Homo sapiens, clone MGC:4164 IMAGE:3610296, mRNA, complete cds
          Length = 2100

 Score =  202 bits (515), Expect = 6e-50
 Identities = 150/507 (29%), Positives = 224/507 (43%), Gaps = 47/507 (9%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV
Sbjct: 365 EAFLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGV 535

Query: 104 PDQT--------------RGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETR 149
            D                R  +K   R+KR+A  G KW  +H++Y + N    + +   R
Sbjct: 536 TDTNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVR 712

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD--SSPFDGEGGFLA 207
            A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG LA
Sbjct: 713 GAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGALA 874

Query: 208 HAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPF 267
           HA+ P     G+ HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP+
Sbjct: 875 HAFLPR---RGEAHFDQDERWSLS--RRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPY 1039

Query: 268 YQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXX 327
           Y+ +  D   L  DD+  +Q +YG                      P             
Sbjct: 1040YKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGKL 1153

Query: 328 XXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMDG 378
                   SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V + 
Sbjct: 1154FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEP 1333

Query: 379 YPMQITYFWRGLPPSIDAVYEN-SEGNFVFFK---------------------SNKFWVF 416
            P+Q    W GLPP+I+A   + ++G+F FFK                       + W F
Sbjct: 1334RPLQER--WVGLPPNIEAAAVSLNDGDFYFFKVQSV*LI*IPTIVGSSLKESRGGRCWRF 1507

Query: 417 KDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP 476
           +      G P   +    G+P H  D+A+++  + +   FKG RY+        ++P YP
Sbjct: 1508RGPKPVWGLPQ--LCRAGGLPRHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYP 1678

Query: 477 KPITIWKGIPESPQGAFVHKENGFTYF 503
           + +  W GIPE   GA    +    +F
Sbjct: 1679RSLQDWGGIPEEVSGALPRPDGSIIFF 1759
 Score = 37.7 bits (86), Expect = 3.3
 Identities = 44/159 (27%), Positives = 62/159 (38%), Gaps = 3/159 (1%)
 Frame = +2

Query: 368  WRVRNNRVMDGYPMQITYFWRGLPPSIDA-VYENSEGNFVFFKSNKFWVFKDTTLQ--PG 424
            WR R  + + G P        GLP   DA ++       + FK  +++V     LQ  P 
Sbjct: 1499 WRFRGPKPVWGLPQLCRA--GGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPY 1672

Query: 425  YPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKG 484
            YP  L   G GIP   +  A+   D G   FF+ DRYWR       +D    +  T  + 
Sbjct: 1673 YPRSLQDWG-GIPEE-VSGALPRPD-GSIIFFRDDRYWR-------LDQAKLQATTSGRW 1822

Query: 485  IPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYP 523
              E P     H  +G   F +   T  +   LR +   P
Sbjct: 1823 ATELPWMGCWHANSGSALF*RHLLTSETGGALRAKSCSP 1939
>ref|XM_083968.1| Homo sapiens matrix metalloproteinase 28 (MMP28), mRNA
          Length = 2096

 Score =  167 bits (422), Expect(2) = 9e-49
 Identities = 115/367 (31%), Positives = 169/367 (45%), Gaps = 12/367 (3%)
 Frame = +2

Query: 149 RKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDS--SPFDGEGGFL 206
           R A+R AF +W NV+ L F E P           DI + F  G H D   + FDG GG L
Sbjct: 344 RGAVRAAFQLWSNVSALEFWEAP------ATGPADIRLTFFQGDHNDGLGNAFDGPGGAL 505

Query: 207 AHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAP 266
           AHA+ P  G   + HFD DE W+L      G +LF+V  HE+GH LGL HS  P A+MAP
Sbjct: 506 AHAFLPRRG---EAHFDQDERWSLSRRR--GRNLFVVLAHEIGHTLGLTHSPAPRALMAP 670

Query: 267 FYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXX 326
           +Y+ +  D   L  DD+  +Q +YG                      P            
Sbjct: 671 YYKRLGRDAL-LSWDDVLAVQSLYG---------------------KPLGGSVAVQLPGK 784

Query: 327 XXXXXXXXXSY-PGAK------PNICDGNFNTLVILR-REMFVFKDQWFWRV-RNNRVMD 377
                    SY P  +      P  C  +F+ + + R +++++FK   FW V  +  V +
Sbjct: 785 LFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSE 964

Query: 378 GYPMQITYFWRGLPPSIDAVYEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGI 436
             P+Q    W GLPP+I+A   + ++G+F FFK  + W F+      G P   +    G+
Sbjct: 965 PRPLQER--WVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQ--LCRAGGL 1132

Query: 437 PSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHK 496
           P H  D+A+++  + +   FKG RY+        ++P YP+ +  W GIPE   GA    
Sbjct: 1133PRHP-DAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRP 1309

Query: 497 ENGFTYF 503
           +    +F
Sbjct: 1310DGSIIFF 1330
 Score = 53.5 bits (127), Expect(2) = 9e-49
 Identities = 34/107 (31%), Positives = 52/107 (47%), Gaps = 14/107 (13%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L+KYGYL    P+     ++     AI A Q    + ++G +DR T+  M +PRCGV D
Sbjct: 6   FLEKYGYLNEQVPKAP---TSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTD 176

Query: 106 Q--------------TRGSSKFNIRRKRYALTGQKWQHKHIAYSIKN 138
                           R  +K   R+KR+A  G KW  +H++Y + N
Sbjct: 177 TNSYAAWAERISDLFARHRTKMR-RKKRFAKQGNKWYKQHLSYRLVN 314
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 44/149 (29%), Positives = 63/149 (41%), Gaps = 9/149 (6%)
 Frame = +2

Query: 393  SIDAVYENSEGNFVFFKSNKFW-VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVG 451
            S DA+  + +     FK + FW V  D  +    P  L     G+P +   +A+   D G
Sbjct: 869  SFDAITVDRQQQLYIFKGSHFWEVAADGNVSE--PRPLQERWVGLPPNIEAAAVSLND-G 1039

Query: 452  KTYFFKGDRYWRYGEEMRSMDPGYPKP-ITIWKGIPESPQGAFVHKE-------NGFTYF 503
              YFFKG R WR+    R   P +  P +    G+P  P  A             G  Y+
Sbjct: 1040 DFYFFKGGRCWRF----RGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYY 1207

Query: 504  IKEKSTGNSTKMLRVEPGYPRSILKDFMG 532
            +  +        L+VEP YPRS L+D+ G
Sbjct: 1208 VLARGG------LQVEPYYPRS-LQDWGG 1273
>emb|X53598.1|PLHE6R P. lividus mRNA for hatching enzyme
          Length = 2880

 Score =  191 bits (486), Expect = 1e-46
 Identities = 153/511 (29%), Positives = 213/511 (40%), Gaps = 53/511 (10%)
 Frame = +1

Query: 42  NVEVW---LQKYGYLPPTDPRMSVLRSAE-TMQSAIAAMQQFYGINMTGKVDRNTIDWMK 97
           NVE+    L+K+GY PP     S    A     SAI   Q+  GIN TG +D +T + + 
Sbjct: 370 NVEILKAHLEKFGYTPPG----STFGEANLNYTSAILDFQEHGGINQTGILDADTAELLS 537

Query: 98  KPRCGVPDQTRGSSKFNIRRKRYALTGQKW-QHKHIAYSIKNVTPKVGDAETRKAIRRAF 156
            PRCGVPD              +  +   W +++ + YS   +T  +   + +  IRRAF
Sbjct: 538 TPRCGVPDVLP-----------FVTSSITWSRNQPVTYSFGALTSDLNQNDVKDEIRRAF 684

Query: 157 DVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGI 216
            VW +V+ L+F EVP          VDI I F S  HGD   FDG GG LAHA+ P    
Sbjct: 685 RVWDDVSGLSFREVP------DTTSVDIRIKFGSYDHGDGISFDGRGGVLAHAFLPR--- 837

Query: 217 GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
            GD HFD  E WT G     G +LF VA HE GH+LGL HS   +A+M P+YQ     NF
Sbjct: 838 NGDAHFDDSETWTEGT--RSGTNLFQVAAHEFGHSLGLYHSTVRSALMYPYYQGY-VPNF 1008

Query: 277 KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
           +L NDD+ GI+ +YG                  R+                        S
Sbjct: 1009RLDNDDIAGIRSLYGSNSGSGTTTTTRRPTTT-RATTTRRTTTTRATTTRATTTTTTSPS 1185

Query: 337 YPGAKPNICDGNFNTLV-ILRREMFVFKDQWFWRVR---------NNRVMDGYPMQI--- 383
            P      C G+F+ +V      ++     +FW++          +NR   G P  I   
Sbjct: 1186RPSPPRRACSGSFDAVVRDSSNRIYALTGPYFWQLDQPSPSWGLVSNRFGFGLPQNIDAS 1365

Query: 384 ------TYF------------------------WRGLPPSIDAVYENSEGNFVFFKSNKF 413
                 TYF                        W GLP +IDAVY +S G   FFK +  
Sbjct: 1366FQRGVVTYFFSECYYYYQTSTQRNFPRIPVNRKWVGLPCNIDAVYRSSRGPTYFFKDSFV 1545

Query: 414 WVFKDTTLQPGYPHDLITLGSGIPS--HGIDSAIWWEDVGKTYFFKGDRYWR---YGEEM 468
           + F            + +L + +PS  H    A+   D    +F++  RY+R   YG + 
Sbjct: 1546YKFNSNNRLQRRTR-ISSLFNDVPSALHDGVEAVVRADRNYIHFYRDGRYYRMTDYGRQF 1722

Query: 469 RSMDPGYPKPITIWKGIPESPQGAFVHKENG 499
            +   G P    I   IP+    +  ++  G
Sbjct: 1723VNFPNGLPYSDVIESVIPQCRGRSLSYESEG 1815
>emb|AL121753.30|HSDJ614O4 Human DNA sequence from clone RP4-614O4 on chromosome 20q11.1-12
             Contains the 3' part of the MMP24 gene for matrix
             metalloproteinase 24 (membrane-inserted), the ITGB4BP gene
             for integrin beta 4 binding protein, a novel gene similar
             to a metalloproteina>
          Length = 150481

 Score =  188 bits (477), Expect = 2e-45
 Identities = 84/103 (81%), Positives = 93/103 (89%)
 Frame = +2

Query: 135   SIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHG 194
             SI N TPKVG+ +TRKAIR+AFDVWQ VTPLTFEEVPY E+++ +++ DI I FASGFHG
Sbjct: 63923 SIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHG 64102

Query: 195   DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
             DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGN NHDG
Sbjct: 64103 DSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDG 64231
 Score =  145 bits (367), Expect = 9e-33
 Identities = 60/87 (68%), Positives = 74/87 (84%)
 Frame = +2

Query: 411   NKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRS 470
             +K+WVFK+ T++PGYPH L  LGS +P  GID+A+ WE VGKTYFFKG+RYWRY EE R+
Sbjct: 81044 DKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRA 81223

Query: 471   MDPGYPKPITIWKGIPESPQGAFVHKE 497
              DPGYPKPIT+WKGIP++PQGAF+ KE
Sbjct: 81224 TDPGYPKPITVWKGIPQAPQGAFISKE 81304
 Score =  120 bits (301), Expect = 4e-25
 Identities = 57/111 (51%), Positives = 81/111 (72%), Gaps = 2/111 (1%)
 Frame = +2

Query: 500   FTYFIKEKSTGN-STKMLRVEPGYPRSILKDFMGCDGP-TDRDKDRHSPQDDVDIIIKLD 557
             +TYF K +       + L VEPGYPR+IL+D+MGC+    +R K+R  PQDDVDI++ ++
Sbjct: 83747 YTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTIN 83926

Query: 558   NTASTVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
             +   +V A+A+VIPCIL+LC+LVLVYT+FQFK +  P+ + Y KR +QEWV
Sbjct: 83927 DVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV 84079
 Score =  110 bits (274), Expect = 5e-22
 Identities = 51/55 (92%), Positives = 53/55 (95%)
 Frame = +2

Query: 237   GNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
             GNDLFLVAVHELGHALGLEHS+DP+AIMAPFYQYMET NFKLP DDLQGIQKIYG
Sbjct: 73265 GNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYG 73429
 Score = 83.2 bits (204), Expect = 7e-14
 Identities = 33/49 (67%), Positives = 40/49 (81%)
 Frame = +3

Query: 363   KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSN 411
             +D+WFWR+RNNRV +GYPMQI  FW+GLP  IDA YE ++G FVFFK N
Sbjct: 79230 QDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGN 79376
 Score = 63.2 bits (152), Expect = 7e-08
 Identities = 28/49 (57%), Positives = 37/49 (75%)
 Frame = +2

Query: 46    WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTID 94
             WL+ YGYL P D R S L SA+ +QSA++ MQQFYGI +TG +D+ TI+
Sbjct: 56318 WLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIE 56464
 Score = 58.9 bits (141), Expect = 1e-06
 Identities = 27/40 (67%), Positives = 29/40 (72%)
 Frame = +1

Query: 95    WMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAY 134
             WMKKPRCGVPD    S +   R KRYALTGQKW+ KHI Y
Sbjct: 61381 WMKKPRCGVPDHPHLSRRR--RNKRYALTGQKWRQKHITY 61494
 Score = 50.1 bits (118), Expect = 6e-04
 Identities = 21/28 (75%), Positives = 23/28 (82%)
 Frame = +3

Query: 336   SYPGAKPNICDGNFNTLVILRREMFVFK 363
             S PG KPNICDGNFNT+ + R EMFVFK
Sbjct: 76809 STPGTKPNICDGNFNTVALFRGEMFVFK 76892
>gb|U65656.1|RNU65656 Rattus norvegicus gelatinase A mRNA, complete cds
          Length = 3053

 Score =  186 bits (473), Expect = 4e-45
 Identities = 117/322 (36%), Positives = 156/322 (48%), Gaps = 8/322 (2%)
 Frame = +1

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            T++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1426 TNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1593

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            NDD++GIQ++YG                   ++ P                         
Sbjct: 1594 NDDIKGIQELYGPSPDADTDTGTGPTP----TLGPVT----------------------- 1692

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 1693 --PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 1866

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 1867 YEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIF 2046

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    
Sbjct: 2047 SGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQ 2226

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++       SI  D++GC
Sbjct: 2227 SLKSVKF-----GSIKSDWLGC 2277
 Score =  129 bits (325), Expect = 6e-28
 Identities = 68/163 (41%), Positives = 91/163 (55%)
 Frame = +1

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 499 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 651

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RA  VW +VTPL F  +      +G  + DI I F
Sbjct: 652 KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRI-----HDG--EADIMINF 810

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 811 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 939
>gb|AY037943.1| Xenopus laevis matrix metalloproteinase mRNA, complete cds
          Length = 2829

 Score =  186 bits (472), Expect = 6e-45
 Identities = 112/307 (36%), Positives = 154/307 (49%), Gaps = 8/307 (2%)
 Frame = +2

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            +++D D  W  G     G  LFLVA HE GHALGLEHS DP A+MAP Y Y++  NF+L 
Sbjct: 1238 SNYDDDRKW--GFCPDQGYSLFLVAAHEFGHALGLEHSQDPGALMAPIYTYIK--NFRLS 1405

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD+ GIQ++YG                    IP                      +   
Sbjct: 1406 QDDITGIQELYGQGSKEKPGPG---------PIP----------------------TMGP 1492

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P++C  D   + +  +R E F FKD++ WR  N R     P+ I  FW  LP  IDAV
Sbjct: 1493 VTPDLCSKDVVLDGMSQIRGETFFFKDRFIWRTPNIRNKPSGPLLIATFWPELPDKIDAV 1672

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTYFF
Sbjct: 1673 YEEPQEEKTVFFAGNEYWVYSSSTLERGYPKKLTSLGLPPDVDRVDAAFNWSKNKKTYFF 1852

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MD G+PK I   W G+P++         +G++YF K+    +  G 
Sbjct: 1853 AGDKFWRYNEVKKKMDTGFPKLIADAWNGVPDNLDAVLDQTGSGYSYFFKDWYYFQVEGK 2032

Query: 512  STKMLRV 518
            S K+++V
Sbjct: 2033 SVKIVKV 2053
 Score =  133 bits (335), Expect = 4e-29
 Identities = 70/163 (42%), Positives = 92/163 (55%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++ A+  MQ F+G+  TG+ D+NTI+ MKKPRCG PD     + +N   ++      KW 
Sbjct: 311 LKDALKKMQSFFGLPETGEFDQNTIETMKKPRCGNPDV----ANYNFFPRK-----PKWD 463

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
             H+ Y I   T  +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 464 KNHLTYRILGYTTDLDSETVDDAFARAFKVWSDVTPLEFNRI-----HDG--EADIMINF 622

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 623 GRWEHGDGYPFDGKDGLLAHAFAPGSGVGGDSHFDDDELWTLG 751
>ref|NM_008610.1| Mus musculus matrix metalloproteinase 2 (Mmp2), mRNA
          Length = 2800

 Score =  184 bits (467), Expect = 2e-44
 Identities = 116/322 (36%), Positives = 156/322 (48%), Gaps = 8/322 (2%)
 Frame = +2

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            T++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1178 TNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1345

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            +DD++GIQ++YG                   ++ P                         
Sbjct: 1346 HDDIKGIQELYGPSPDADTDTGTGPTP----TLGPVT----------------------- 1444

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 1445 --PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 1618

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 1619 YEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIF 1798

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    
Sbjct: 1799 AGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQ 1978

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++       SI  D++GC
Sbjct: 1979 SLKSVKF-----GSIKSDWLGC 2029
 Score =  129 bits (325), Expect = 6e-28
 Identities = 68/163 (41%), Positives = 91/163 (55%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 251 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 403

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RA  VW +VTPL F  +      +G  + DI I F
Sbjct: 404 KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRI-----HDG--EADIMINF 562

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 563 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 691
>gb|M84324.1|MUSIVCOL Mus musculus type IV collagenase mRNA, complete cds
          Length = 2800

 Score =  184 bits (467), Expect = 2e-44
 Identities = 116/322 (36%), Positives = 156/322 (48%), Gaps = 8/322 (2%)
 Frame = +2

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            T++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1178 TNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1345

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            +DD++GIQ++YG                   ++ P                         
Sbjct: 1346 HDDIKGIQELYGPSPDADTDTGTGPTP----TLGPVT----------------------- 1444

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 1445 --PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 1618

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 1619 YEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIF 1798

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    
Sbjct: 1799 AGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQ 1978

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++       SI  D++GC
Sbjct: 1979 SLKSVKF-----GSIKSDWLGC 2029
 Score =  129 bits (325), Expect = 6e-28
 Identities = 68/163 (41%), Positives = 91/163 (55%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 251 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 403

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RA  VW +VTPL F  +      +G  + DI I F
Sbjct: 404 KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRI-----HDG--EADIMINF 562

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 563 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 691
>dbj|AB021698.1|AB021698 Oncorhynchus mykiss mRNA for matrix metalloproteinase-2, complete cds
          Length = 3035

 Score =  184 bits (467), Expect = 2e-44
 Identities = 118/329 (35%), Positives = 161/329 (48%), Gaps = 8/329 (2%)
 Frame = +3

Query: 222  FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
            +D D  W  G     G  LFLVA HE GHALGLEHS DP A+MAP Y +  T NF+L ND
Sbjct: 1260 YDDDRKW--GFCPDQGYSLFLVAAHEFGHALGLEHSQDPGALMAPMYTF--TKNFRLSND 1427

Query: 282  DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
            D++GIQ++YG                  + +PP                       P   
Sbjct: 1428 DIKGIQELYGAGTD--------------KPVPPTQG--------------------PVTP 1505

Query: 342  PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             +IC+    F+ +  +R E F FKD++ +R  N R     PM +  +W  LP +IDA YE
Sbjct: 1506 MDICNEPVVFDAVAQIRGETFFFKDRFIFRSTNFRGKPSGPMLVATYWPELPVTIDAAYE 1685

Query: 400  NS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
            N  E   VFF  N+ W+F    ++ GYP  + ++G      GID+A  +    KTY F G
Sbjct: 1686 NPLEEKTVFFAGNEMWIFNADQIEKGYPKRISSIGLPTDLKGIDAAFSFGKSQKTYLFAG 1865

Query: 459  DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNST 513
            D++WRY E  + MD G+PK I   W GIP+    AF      +TYF K     K   +S 
Sbjct: 1866 DQFWRYNEAKKKMDLGFPKLIADSWNGIPDGIDSAFSLNGIDYTYFFKGAHYFKMDDSSL 2045

Query: 514  KMLRVEPGYPRSILKDFMGCDGPTDRDKD 542
            K++++       I KD++GC   T R  D
Sbjct: 2046 KIVKL-----GEITKDWLGCH*ATVRRID 2117
 Score =  134 bits (337), Expect = 3e-29
 Identities = 70/163 (42%), Positives = 94/163 (56%)
 Frame = +3

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+ +  TG++D  T++ MKKPRCGVPD     +++N   ++      KWQ
Sbjct: 327 LKDTLKKMQKFFSLQETGEIDPKTVEIMKKPRCGVPDV----AQYNFFHRK-----PKWQ 479

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   +P + +     A  RAF VW +VTPL F       L +G  + DI I F
Sbjct: 480 QNAITYRILGHSPDLDEETIDDAFLRAFKVWSDVTPLKFTR-----LMDG--EADIMINF 638

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PGPG GGD+HFD DE WTLG
Sbjct: 639 GRNEHGDGYPFDGKDGLLAHAFAPGPGTGGDSHFDDDEQWTLG 767
>ref|NM_031054.1| Rattus norvegicus matrix metalloproteinase 2 (72 KDa type IV
            collagenase) (Mmp2), mRNA
          Length = 3231

 Score =  184 bits (467), Expect = 2e-44
 Identities = 116/322 (36%), Positives = 156/322 (48%), Gaps = 8/322 (2%)
 Frame = +3

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            T++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1608 TNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1775

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            +DD++GIQ++YG                   ++ P                         
Sbjct: 1776 HDDIKGIQELYGPSPDADTDTGTGPTP----TLGPVT----------------------- 1874

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 1875 --PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 2048

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 2049 YEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIF 2228

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    
Sbjct: 2229 AGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQ 2408

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++       SI  D++GC
Sbjct: 2409 SLKSVKF-----GSIKSDWLGC 2459
 Score =  129 bits (325), Expect = 6e-28
 Identities = 68/163 (41%), Positives = 91/163 (55%)
 Frame = +3

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 681 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 833

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RA  VW +VTPL F  +      +G  + DI I F
Sbjct: 834 KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRI-----HDG--EADIMINF 992

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 993 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 1121
>emb|X71466.1|RNCOLL R. Norvegicus mRNA for 72 KDa type IV collagenase
          Length = 3231

 Score =  184 bits (467), Expect = 2e-44
 Identities = 116/322 (36%), Positives = 156/322 (48%), Gaps = 8/322 (2%)
 Frame = +3

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            T++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1608 TNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1775

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            +DD++GIQ++YG                   ++ P                         
Sbjct: 1776 HDDIKGIQELYGPSPDADTDTGTGPTP----TLGPVT----------------------- 1874

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 1875 --PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 2048

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 2049 YEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIF 2228

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    
Sbjct: 2229 AGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQ 2408

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++       SI  D++GC
Sbjct: 2409 SLKSVKF-----GSIKSDWLGC 2459
 Score =  129 bits (325), Expect = 6e-28
 Identities = 68/163 (41%), Positives = 91/163 (55%)
 Frame = +3

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 681 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 833

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RA  VW +VTPL F  +      +G  + DI I F
Sbjct: 834 KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRI-----HDG--EADIMINF 992

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 993 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 1121
>dbj|AB031323.1|AB031323 Sus scrofa mRNA for matrilysin, complete cds
          Length = 968

 Score =  184 bits (466), Expect = 3e-44
 Identities = 99/248 (39%), Positives = 139/248 (55%), Gaps = 2/248 (0%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q  GYL    P  S  + A ++++ +  MQ+F+ + +TG ++ + I  M+KPRCGVPD
Sbjct: 102 WEQAQGYLKKFYPSNSKTKDANSLEAKLKQMQKFFRLPITGMLNSHIIKIMQKPRCGVPD 281

Query: 106 QTRGSSKFNIRRKRYAL--TGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
                         Y+L  +  KW  K + Y I + T  +      + + +A  +W N  
Sbjct: 282 VAE-----------YSLFPSQPKWTSKIVTYRIVSYTRDLPHVTVNQLVTKALKMWSNEI 428

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PL+F++V +          DI I FA G HGD+ PFDG G  LAHA+ PGPG+GGD HFD
Sbjct: 429 PLSFKKVSW-------GIADIIIGFARGAHGDAYPFDGPGNTLAHAFAPGPGLGGDAHFD 587

Query: 224 SDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDL 283
            DE W+ G     G +    A HELGH+LGL HS+DP A+M P Y  + + +FKL  DD+
Sbjct: 588 EDEHWSDG--GSIGINFLYAATHELGHSLGLAHSSDPNAVMYPTYGEVYSKDFKLSQDDI 761

Query: 284 QGIQKIYG 291
            GIQK+YG
Sbjct: 762 NGIQKLYG 785
>gb|AF290428.1|AF290428 Bos taurus matrix metalloprotease 2 mRNA, complete cds
          Length = 2350

 Score =  184 bits (466), Expect = 3e-44
 Identities = 115/322 (35%), Positives = 157/322 (48%), Gaps = 8/322 (2%)
 Frame = +2

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            +++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1319 SNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1486

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
            +DD+QGIQ++YG                   ++ P                         
Sbjct: 1487 HDDIQGIQELYGASPDIDTGTGPTP------TLGPVT----------------------- 1579

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P +C  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 1580 --PELCKQDIVFDGISQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 1753

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE+  E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 1754 YEDPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPGVQKVDAAFNWSKNKKTYIF 1933

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    
Sbjct: 1934 AGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQ 2113

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++       SI  D++GC
Sbjct: 2114 SLKSVKF-----GSIKSDWLGC 2164
 Score =  129 bits (323), Expect = 1e-27
 Identities = 68/163 (41%), Positives = 93/163 (56%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG++D++TI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 392 LKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 544

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 545 KNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRI-----HDG--EADIMINF 703

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PGPG+GGD+HFD DE  TLG
Sbjct: 704 GRWEHGDGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELRTLG 832
>dbj|AB033754.2|AB033754 Oryzias latipes gel-a mRNA for gelatinase A, complete cds
          Length = 3019

 Score =  182 bits (463), Expect = 6e-44
 Identities = 116/320 (36%), Positives = 159/320 (49%), Gaps = 8/320 (2%)
 Frame = +1

Query: 222  FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
            +D D  W  G     G  LFLVA HE GHALGLEHS DP A+MAP Y +  T +F+LP D
Sbjct: 1240 YDDDRKW--GFCPDQGYSLFLVAAHEFGHALGLEHSQDPGALMAPVYTF--TKDFRLPQD 1407

Query: 282  DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
            D+QGIQ++YG                  + +PP                       P   
Sbjct: 1408 DIQGIQELYGVPTD--------------KPLPPTQG--------------------PVTP 1485

Query: 342  PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             +IC  +  F+ +  +R E F FKD++ +R  N R     P+ +  +W  LP  IDA YE
Sbjct: 1486 MDICKESIVFDAVAQIRGETFFFKDRFLFRSVNFRSKPKGPLLVATYWPDLPAKIDAAYE 1665

Query: 400  N-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
            N +E   VFF  N+FWV++   LQ GYP  L  L        ID+A  +    KTY F G
Sbjct: 1666 NPAEEKTVFFAGNQFWVYRADELQSGYPRRLSNLDLPDDVQRIDAAFNFRRNRKTYLFSG 1845

Query: 459  DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNST 513
            D++WRY E+ ++MDPG+PK I   W GIP+    AF      ++YF K     K   N+ 
Sbjct: 1846 DKFWRYDEDRKTMDPGFPKLIADSWNGIPDDLDSAFSLNGIDYSYFFKGNHYFKLEDNTL 2025

Query: 514  KMLRVEPGYPRSILKDFMGC 533
            K++++       I  D++GC
Sbjct: 2026 KIVKL-----GEIKTDWLGC 2070
 Score =  133 bits (334), Expect = 6e-29
 Identities = 69/163 (42%), Positives = 91/163 (55%)
 Frame = +1

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+ +  TG++D  T+  MKKPRCGVPD     + +N    +      KWQ
Sbjct: 307 LKDTLKTMQKFFTLPETGEIDAQTVAIMKKPRCGVPDV----ANYNFFHNK-----PKWQ 459

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
            K I Y I   +P + +     A  RAF VW +VTPL+F  +          + DI I F
Sbjct: 460 KKDITYRILGYSPDLDEEVINDAFYRAFKVWSDVTPLSFTRIM-------DGEADIMINF 618

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG GIGGD+HFD DE WTLG
Sbjct: 619 GRNEHGDGYPFDGKDGLLAHAFAPGGGIGGDSHFDDDEQWTLG 747
>dbj|D63579.1|RABMM2 Oryctolagus cuniculus mRNA for matrix metalloproteinase-2, complete
            cds
          Length = 2678

 Score =  182 bits (461), Expect = 1e-43
 Identities = 115/322 (35%), Positives = 155/322 (47%), Gaps = 8/322 (2%)
 Frame = +1

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            T++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 1135 TNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 1302

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD++GIQ++YG                   ++ P                         
Sbjct: 1303 QDDIKGIQELYGASPDAGTDAGTGPTP----TLGPVT----------------------- 1401

Query: 340  AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
              P IC  D  F+ +  +R E+F FKD++ WR          P+ +  FW  LP  IDAV
Sbjct: 1402 --PEICTQDIVFDGIAQIRGEIFFFKDRFIWRTVTPGDKPMGPLLVATFWPELPEKIDAV 1575

Query: 398  YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            YE   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 1576 YEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIF 1755

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGN 511
             GD++WRY E  + MDPG+P+ I   W  IP+        + +G +YF K     K    
Sbjct: 1756 AGDKFWRYNEVKKKMDPGFPRLIADAWNAIPDHLDAVVDLQGSGHSYFFKGTYYLKLENQ 1935

Query: 512  STKMLRVEPGYPRSILKDFMGC 533
            S K ++V      SI  D++GC
Sbjct: 1936 SLKSVKV-----GSIKTDWLGC 1986
 Score =  133 bits (334), Expect = 6e-29
 Identities = 69/163 (42%), Positives = 93/163 (56%)
 Frame = +1

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG++D++TI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 208 LKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 360

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW NVTPL F  +      +G  + DI I F
Sbjct: 361 KNQITYRIIGYTPDLDPETVDDAFARAFQVWSNVTPLRFSRI-----HDG--EADIMINF 519

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 520 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 648
>gb|AF177217.1|AF177217 Canis familiaris matrix metalloproteinase-2 (MMP-2) mRNA, partial cds
          Length = 2522

 Score =  182 bits (461), Expect = 1e-43
 Identities = 115/321 (35%), Positives = 155/321 (47%), Gaps = 8/321 (2%)
 Frame = +3

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L  
Sbjct: 1056 NYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTY--TKNFRLSQ 1223

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ++YG                   ++ P                          
Sbjct: 1224 DDIKGIQELYGASPDAGTGTGPTP------TLGPVT------------------------ 1313

Query: 341  KPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
             P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAVY
Sbjct: 1314 -PEICKQDIVFDGISQIRGEIFFFKDRFIWRTVTPRNKPMGPLLVATFWPELPEKIDAVY 1490

Query: 399  EN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F 
Sbjct: 1491 EAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFA 1670

Query: 458  GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNS 512
            GD++WRY E  + MDPG+PK I   W  IP++       + +G +YF K     K    S
Sbjct: 1671 GDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQS 1850

Query: 513  TKMLRVEPGYPRSILKDFMGC 533
             K ++       SI  D++GC
Sbjct: 1851 LKSVKF-----GSIKSDWLGC 1898
 Score =  134 bits (337), Expect = 3e-29
 Identities = 69/163 (42%), Positives = 94/163 (57%)
 Frame = +3

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG++D++TI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 126 LKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 278

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 279 KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRI-----HDG--EADIMINF 437

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PGPG+GGD+HFD DE WTLG
Sbjct: 438 GRWEHGDGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLG 566
>gb|J03210.1|HUMCN4GEL Human collagenase type IV mRNA, 3' end
          Length = 2733

 Score =  181 bits (459), Expect = 2e-43
 Identities = 114/321 (35%), Positives = 154/321 (47%), Gaps = 8/321 (2%)
 Frame = +2

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L  
Sbjct: 1091 NYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 1258

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ++YG                   ++ P                          
Sbjct: 1259 DDIKGIQELYGASPDIDLGTGPTP------TLGPVT------------------------ 1348

Query: 341  KPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
             P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAVY
Sbjct: 1349 -PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVY 1525

Query: 399  EN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E   E   VFF  N++W++  +TL+ GYP  L +LG       +D+A  W    KTY F 
Sbjct: 1526 EAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFA 1705

Query: 458  GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNS 512
            GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    S
Sbjct: 1706 GDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQS 1885

Query: 513  TKMLRVEPGYPRSILKDFMGC 533
             K ++       SI  D++GC
Sbjct: 1886 LKSVKF-----GSIKSDWLGC 1933
 Score =  132 bits (332), Expect = 1e-28
 Identities = 69/163 (42%), Positives = 92/163 (56%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 161 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 313

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 314 KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRI-----HDG--EADIMINF 472

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 473 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 601
>ref|XM_012503.2| Homo sapiens matrix metalloproteinase 2 (gelatinase A, 72kD
            gelatinase, 72kD type IV collagenase) (MMP2), mRNA
          Length = 3069

 Score =  181 bits (459), Expect = 2e-43
 Identities = 114/321 (35%), Positives = 154/321 (47%), Gaps = 8/321 (2%)
 Frame = +2

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L  
Sbjct: 1427 NYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 1594

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ++YG                   ++ P                          
Sbjct: 1595 DDIKGIQELYGASPDIDLGTGPTP------TLGPVT------------------------ 1684

Query: 341  KPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
             P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAVY
Sbjct: 1685 -PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVY 1861

Query: 399  EN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E   E   VFF  N++W++  +TL+ GYP  L +LG       +D+A  W    KTY F 
Sbjct: 1862 EAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFA 2041

Query: 458  GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNS 512
            GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    S
Sbjct: 2042 GDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQS 2221

Query: 513  TKMLRVEPGYPRSILKDFMGC 533
             K ++       SI  D++GC
Sbjct: 2222 LKSVKF-----GSIKSDWLGC 2269
 Score =  132 bits (332), Expect = 1e-28
 Identities = 69/163 (42%), Positives = 92/163 (56%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 497 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 649

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 650 KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRI-----HDG--EADIMINF 808

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 809 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 937
>ref|NM_004530.1| Homo sapiens matrix metalloproteinase 2 (gelatinase A, 72kD
            gelatinase, 72kD type IV collagenase) (MMP2), mRNA
          Length = 3069

 Score =  181 bits (459), Expect = 2e-43
 Identities = 114/321 (35%), Positives = 154/321 (47%), Gaps = 8/321 (2%)
 Frame = +2

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L  
Sbjct: 1427 NYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 1594

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ++YG                   ++ P                          
Sbjct: 1595 DDIKGIQELYGASPDIDLGTGPTP------TLGPVT------------------------ 1684

Query: 341  KPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
             P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAVY
Sbjct: 1685 -PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVY 1861

Query: 399  EN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E   E   VFF  N++W++  +TL+ GYP  L +LG       +D+A  W    KTY F 
Sbjct: 1862 EAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFA 2041

Query: 458  GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNS 512
            GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    S
Sbjct: 2042 GDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQS 2221

Query: 513  TKMLRVEPGYPRSILKDFMGC 533
             K ++       SI  D++GC
Sbjct: 2222 LKSVKF-----GSIKSDWLGC 2269
 Score =  132 bits (332), Expect = 1e-28
 Identities = 69/163 (42%), Positives = 92/163 (56%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 497 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 649

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 650 KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRI-----HDG--EADIMINF 808

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 809 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 937
>gb|BC002576.1|BC002576 Homo sapiens, matrix metalloproteinase 2 (gelatinase A, 72kD
            gelatinase, 72kD type IV collagenase), clone MGC:2313
            IMAGE:3161383, mRNA, complete cds
          Length = 3074

 Score =  181 bits (459), Expect = 2e-43
 Identities = 114/321 (35%), Positives = 154/321 (47%), Gaps = 8/321 (2%)
 Frame = +3

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L  
Sbjct: 1413 NYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 1580

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ++YG                   ++ P                          
Sbjct: 1581 DDIKGIQELYGASPDIDLGTGPTP------TLGPVT------------------------ 1670

Query: 341  KPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
             P IC  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAVY
Sbjct: 1671 -PEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVY 1847

Query: 399  EN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E   E   VFF  N++W++  +TL+ GYP  L +LG       +D+A  W    KTY F 
Sbjct: 1848 EAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFA 2027

Query: 458  GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNS 512
            GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    S
Sbjct: 2028 GDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQS 2207

Query: 513  TKMLRVEPGYPRSILKDFMGC 533
             K ++       SI  D++GC
Sbjct: 2208 LKSVKF-----GSIKSDWLGC 2255
 Score =  132 bits (332), Expect = 1e-28
 Identities = 69/163 (42%), Positives = 92/163 (56%)
 Frame = +3

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG +D+NTI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 483 LKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 635

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 636 KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRI-----HDG--EADIMINF 794

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PG G+GGD+HFD DE WTLG
Sbjct: 795 GRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG 923
>gb|U07775.1|GGU07775 Gallus gallus prepro-72kDa matrix metalloproteinase (MMP-2) mRNA,
            complete cds
          Length = 3073

 Score =  179 bits (454), Expect = 7e-43
 Identities = 111/320 (34%), Positives = 155/320 (47%), Gaps = 8/320 (2%)
 Frame = +3

Query: 222  FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
            +D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L  D
Sbjct: 1263 YDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTY--TKNFRLSQD 1430

Query: 282  DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
            D++GIQ++Y                    ++ P                           
Sbjct: 1431 DIKGIQELYEVSPDVEPGPGPGPGPGPRPTLGPVT------------------------- 1535

Query: 342  PNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
            P +C  D  F+ +  +R E+F FKD++ WR  N R     P+ +  FW  LP  IDAVYE
Sbjct: 1536 PELCKHDIVFDGVAQIRGEIFFFKDRFMWRTVNPRGKPTGPLLVATFWPDLPEKIDAVYE 1715

Query: 400  NSEGN-FVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
            + +    VFF  N++WV+  + L  GYP  L +LG       ID+A  W    KTY F G
Sbjct: 1716 SPQDEKAVFFAGNEYWVYTASNLDRGYPKKLTSLGLPPDVQRIDAAFNWGRNKKTYIFSG 1895

Query: 459  DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNST 513
            DRYW+Y EE + M+   PK I   W G+P++        ++G+TYF K+    +    S 
Sbjct: 1896 DRYWKYNEEKKKMELATPKFIADSWNGVPDNLDAVLGLTDSGYTYFFKDQYYLQMEDKSL 2075

Query: 514  KMLRVEPGYPRSILKDFMGC 533
            K++++       I  D++GC
Sbjct: 2076 KIVKI-----GKISSDWLGC 2120
 Score =  141 bits (356), Expect = 2e-31
 Identities = 78/186 (41%), Positives = 101/186 (53%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +L KY   P  +  + VL+        +  MQ+F+G+  TG +D+NTI+ MKKPRCG PD
Sbjct: 279 YLNKYYGCPKDNCNLFVLKDT------LKKMQKFFGLPETGDLDQNTIETMKKPRCGNPD 440

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                + +N   ++      KW+  HI Y I   TP +       A  RAF VW +VTPL
Sbjct: 441 V----ANYNFFPRK-----PKWEKNHITYRIIGYTPDLDPETVDDAFARAFKVWSDVTPL 593

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F  +          + DI I F    HGD  PFDG+ G LAHA+ PGPGIGGD+HFD D
Sbjct: 594 RFNRI-------NDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGPGIGGDSHFDDD 752

Query: 226 EPWTLG 231
           E WTLG
Sbjct: 753 ELWTLG 770
>gb|BC003635.1|BC003635 Homo sapiens, matrix metalloproteinase 7 (matrilysin, uterine),
           clone MGC:3913 IMAGE:3545760, mRNA, complete cds
          Length = 1140

 Score =  178 bits (452), Expect = 1e-42
 Identities = 98/246 (39%), Positives = 136/246 (54%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  ++A ++++ +  MQ+F+G+ +TG ++ + I+ M+KPRCGVPD
Sbjct: 134 WEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPD 313

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  K + Y I + T  +      + + +A ++W    PL
Sbjct: 314 VAEYSLFPN---------SPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPL 466

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F +V +          DI I FA G HGDS PFDG G  LAHA+ PG G+GGD HFD D
Sbjct: 467 HFRKVVW-------GTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDED 625

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT G+    G +    A HELGH+LG+ HS+DP A+M P Y   +  NFKL  DD++G
Sbjct: 626 ERWTDGSSL--GINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKG 799

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 800 IQKLYG 817
>ref|NM_002423.2| Homo sapiens matrix metalloproteinase 7 (matrilysin, uterine)
           (MMP7), mRNA
          Length = 1127

 Score =  178 bits (451), Expect = 2e-42
 Identities = 98/246 (39%), Positives = 135/246 (54%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  ++A ++++ +  MQ+F+G+ +TG ++   I+ M+KPRCGVPD
Sbjct: 141 WEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPD 320

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  K + Y I + T  +      + + +A ++W    PL
Sbjct: 321 VAEYSLFPN---------SPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPL 473

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F +V +          DI I FA G HGDS PFDG G  LAHA+ PG G+GGD HFD D
Sbjct: 474 HFRKVVW-------GTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDED 632

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT G+    G +    A HELGH+LG+ HS+DP A+M P Y   +  NFKL  DD++G
Sbjct: 633 ERWTDGSSL--GINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKG 806

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 807 IQKLYG 824
>emb|X07819.1|HSPUMP1 Human pump-1 mRNA homolog. to metalloproteinase, collagenase and
           stromelysin
          Length = 1078

 Score =  178 bits (451), Expect = 2e-42
 Identities = 98/246 (39%), Positives = 135/246 (54%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  ++A ++++ +  MQ+F+G+ +TG ++   I+ M+KPRCGVPD
Sbjct: 121 WEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPD 300

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  K + Y I + T  +      + + +A ++W    PL
Sbjct: 301 VAEYSLFPN---------SPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPL 453

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F +V +          DI I FA G HGDS PFDG G  LAHA+ PG G+GGD HFD D
Sbjct: 454 HFRKVVW-------GTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDED 612

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT G+    G +    A HELGH+LG+ HS+DP A+M P Y   +  NFKL  DD++G
Sbjct: 613 ERWTDGSSL--GINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKG 786

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 787 IQKLYG 804
>emb|Z11887.1|HSPUMP1G H.sapiens PUMP-1 gene encoding PUMP
          Length = 1132

 Score =  178 bits (451), Expect = 2e-42
 Identities = 98/246 (39%), Positives = 135/246 (54%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  ++A ++++ +  MQ+F+G+ +TG ++   I+ M+KPRCGVPD
Sbjct: 121 WEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPD 300

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  K + Y I + T  +      + + +A ++W    PL
Sbjct: 301 VAEYSLFPN---------SPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPL 453

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F +V +          DI I FA G HGDS PFDG G  LAHA+ PG G+GGD HFD D
Sbjct: 454 HFRKVVW-------GTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDED 612

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT G+    G +    A HELGH+LG+ HS+DP A+M P Y   +  NFKL  DD++G
Sbjct: 613 ERWTDGSSL--GINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKG 786

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 787 IQKLYG 804
>gb|AF295805.1|AF295805 Sus scrofa gelatinase A (MMP-2) mRNA, complete cds
          Length = 2857

 Score =  175 bits (443), Expect = 1e-41
 Identities = 114/321 (35%), Positives = 152/321 (46%), Gaps = 8/321 (2%)
 Frame = +1

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L +
Sbjct: 1189 NYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTY--TKNFRLSH 1356

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ++YG                   ++ P                          
Sbjct: 1357 DDVKGIQELYGASPDIDTGTGPTP------TLGPVT------------------------ 1446

Query: 341  KPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
             P IC  D  F+ +  +R E+F FKD++ WR    R           FW  LP  IDAVY
Sbjct: 1447 -PEICKQDIVFDGISQIRGEIFFFKDRFIWRTVTPRDKPMVAPAGATFWPELPEKIDAVY 1623

Query: 399  EN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E   E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F 
Sbjct: 1624 EAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFA 1803

Query: 458  GDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNS 512
            GD++WRY E  + MDPG+PK I   W  IP++       +  G +YF K     K    S
Sbjct: 1804 GDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQS 1983

Query: 513  TKMLRVEPGYPRSILKDFMGC 533
             K ++       SI  D++GC
Sbjct: 1984 LKSVKF-----GSIKSDWLGC 2031
 Score =  133 bits (334), Expect = 6e-29
 Identities = 69/163 (42%), Positives = 94/163 (57%)
 Frame = +1

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+G+  TG++D++TI+ M+KPRCG PD     + +N   ++      KW 
Sbjct: 259 LKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDV----ANYNFFPRK-----PKWD 411

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   TP +       A  RAF VW +VTPL F  +      +G  + DI I F
Sbjct: 412 KTQITYRIIGYTPDLDPETVDDAFARAFRVWSDVTPLRFSRI-----HDG--EADIMINF 570

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG 231
               HGD  PFDG+ G LAHA+ PGPG+GGD+HFD DE WTLG
Sbjct: 571 GRWEHGDGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLG 699
>dbj|AB000719.1|AB000719 Hemicentrotus pulcherrimus mRNA for hatching enzyme, complete cds
          Length = 2463

 Score =  174 bits (441), Expect = 2e-41
 Identities = 129/423 (30%), Positives = 193/423 (45%), Gaps = 5/423 (1%)
 Frame = +1

Query: 47  LQKYGYLPPTDPRMSVLRSAE-TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           L+++GY+P      S    A     SAI   QQ  GIN TG +D  T   +  PRCGVPD
Sbjct: 373 LEQFGYVPLG----STFGEANINYTSAILEYQQNGGINQTGILDAETAALLDTPRCGVPD 540

Query: 106 QTRGSSKFNIRRKRYALTGQKW-QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTP 164
                         Y   G  W ++  + YS   ++  +     +  +RRAF VW +V+ 
Sbjct: 541 ILP-----------YVTGGIAWPRNVAVTYSFGTLSNDLSQTAIKNELRRAFQVWDDVSS 687

Query: 165 LTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDS 224
           LTF EV           VDI I F S  HGD   FDG+GG LAHA+ P     GD HFD 
Sbjct: 688 LTFREVV------DSSSVDIRIKFGSYEHGDGISFDGQGGVLAHAFLPR---NGDAHFDD 840

Query: 225 DEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQ 284
            E WT+G   + G +LF VA HE GH+LGL HS+  +A+M P+Y+     NF L  DD+ 
Sbjct: 841 SERWTIGT--NSGTNLFQVAAHEFGHSLGLYHSDVQSALMYPYYRGY-NPNFNLDRDDIA 1011

Query: 285 GIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNI 344
           GI  +YG                   +                        +YP      
Sbjct: 1012GITSLYG-RNTGSTTTTTRRPTITRTTTRRTTTRRTTTQLATTQTTTIRPPTYPTPPRQA 1188

Query: 345 CDGNFNTLVILRRE-MFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEG 403
           C G+F+ ++    + ++    +++WR+  ++    + +    F   LP ++DA ++N  G
Sbjct: 1189CTGSFDAVIKDNSDRIYALAGRYYWRL--DQASPSWGVVRNRFGFDLPENVDASFQN--G 1356

Query: 404 NFVFFKSNKFWVFKDTTLQ--PGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRY 461
            F +F S  ++ ++ +T +  P  P +   +  G+P   ID+     D G TYFFKG   
Sbjct: 1357IFSYFFSGCYYYYQTSTRRRFPRTPFNRRWV--GLPC-DIDAVYKSGDSGTTYFFKGRFV 1527

Query: 462 WRY 464
           +++
Sbjct: 1528YKF 1536
>ref|NM_012864.1| Rattus norvegicus Matrix metalloproteinase 7 (matrilysin) (Mmp7),
           mRNA
          Length = 1057

 Score =  173 bits (439), Expect = 4e-41
 Identities = 96/246 (39%), Positives = 131/246 (53%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  + A +    +  MQ+F+G+  TGK+    ++ M+KPRCGVPD
Sbjct: 136 WEQAQNYLRKFYLHDSKTKKATSAVDKLREMQKFFGLPETGKLSPRVMEIMQKPRCGVPD 315

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  + + Y I + T  +      + ++RA  +W    PL
Sbjct: 316 VAEFSLMPN---------SPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPL 468

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F+ V +          DI I FA G HGD+ PFDG G  L HA+ PGPG+GGD HFD D
Sbjct: 469 NFKRVSW-------GTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKD 627

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT G  +  G +   VA HELGH+LGL HS+ P+++M P YQ   +++F L  DD+ G
Sbjct: 628 EYWTDGEDS--GVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAG 801

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 802 IQKLYG 819
>gb|L24374.1|RATMPMM Rattus norvegicus matrilysin (MMP-7) mRNA, complete cds
          Length = 1057

 Score =  173 bits (439), Expect = 4e-41
 Identities = 96/246 (39%), Positives = 131/246 (53%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  + A +    +  MQ+F+G+  TGK+    ++ M+KPRCGVPD
Sbjct: 136 WEQAQNYLRKFYLHDSKTKKATSAVDKLREMQKFFGLPETGKLSPRVMEIMQKPRCGVPD 315

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  + + Y I + T  +      + ++RA  +W    PL
Sbjct: 316 VAEFSLMPN---------SPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPL 468

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F+ V +          DI I FA G HGD+ PFDG G  L HA+ PGPG+GGD HFD D
Sbjct: 469 NFKRVSW-------GTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKD 627

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT G  +  G +   VA HELGH+LGL HS+ P+++M P YQ   +++F L  DD+ G
Sbjct: 628 EYWTDGEDS--GVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAG 801

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 802 IQKLYG 819
>dbj|AB057752.1|AB057752 Paralichthys olivaceus MMP2 mRNA for gelatinase, complete cds
          Length = 3245

 Score =  170 bits (431), Expect = 3e-40
 Identities = 111/320 (34%), Positives = 151/320 (46%), Gaps = 8/320 (2%)
 Frame = +2

Query: 222  FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
            +D D  W  G     G  LFLVA HE GHALGLEHS DP A+MAP Y +  T +F+L +D
Sbjct: 1322 YDDDRKW--GFCPDQGYSLFLVAAHEFGHALGLEHSQDPGALMAPIYTF--TKDFRLSHD 1489

Query: 282  DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
            D+QGIQ++YG                                              P   
Sbjct: 1490 DVQGIQELYGASTDQPQTPTQG----------------------------------PVTP 1567

Query: 342  PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
             +IC     F+ +  +R E F FKD++ +R  N R     PM +  +W  LP  IDA YE
Sbjct: 1568 MDICKEPVVFDAIAQIRGETFFFKDRFLFRSVNYRSKPSGPMLVATYWPELPAKIDAAYE 1747

Query: 400  NS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
            N  E   VFF   + WV+K   L+ GYP  + +L        ID+A  +    KTY F G
Sbjct: 1748 NPLEEKTVFFSGKEMWVYKANDLERGYPKKISSLDLPTDLSQIDAAFNFRKNKKTYLFAG 1927

Query: 459  DRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE----KSTGNST 513
            D++WRY EE + MD G+P+ I   W GIP+    AF      ++YF K     K   +S 
Sbjct: 1928 DKFWRYDEETKIMDAGFPRLIADSWNGIPDGLDSAFSLNGIDYSYFFKGNHYFKLEDSSL 2107

Query: 514  KMLRVEPGYPRSILKDFMGC 533
            K++++       I KD++GC
Sbjct: 2108 KIVKL-----GEITKDWLGC 2152
 Score =  132 bits (331), Expect = 1e-28
 Identities = 69/164 (42%), Positives = 94/164 (57%)
 Frame = +2

Query: 69  MQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQ 128
           ++  +  MQ+F+ +  TG++D  T++ MKKPRCGVPD     + +N   ++       WQ
Sbjct: 389 LKDTLKKMQKFFSLQETGEIDAKTVEIMKKPRCGVPDV----ANYNFFHRK-----PMWQ 541

Query: 129 HKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIF 188
              I Y I   +  + +     A  RAF VW +VTPL+F       L +G  + DI I F
Sbjct: 542 KNDITYRILGYSLDLDEEVINDAFFRAFKVWSDVTPLSFTR-----LMDG--EADIMINF 700

Query: 189 ASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGN 232
               HGD  PFDG+ G LAHA+ PGPGIGGD+HFD DE WTLG+
Sbjct: 701 GRNEHGDGYPFDGKDGLLAHAFAPGPGIGGDSHFDDDEQWTLGD 832
>gb|AF144759.1|AF144759 Bos taurus MT2-MMP protein (MMP-15) mRNA, partial cds
          Length = 380

 Score =  170 bits (431), Expect = 3e-40
 Identities = 70/125 (56%), Positives = 92/125 (73%)
 Frame = +3

Query: 373 NRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITL 432
           N V+D YPM I +FWRGLP  I A YE  +G FVFFK +++W+F++  L+PGYP  L + 
Sbjct: 3   NCVLDNYPMPIGHFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSY 182

Query: 433 GSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGA 492
           G GIP   ID+AIWWE  G T+FF+ DRYWR+ EE +  DPGYPKPI++W+GIP SP+GA
Sbjct: 183 GLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGA 362

Query: 493 FVHKE 497
           F+  +
Sbjct: 363 FLSND 377
 Score = 46.6 bits (109), Expect = 0.007
 Identities = 27/81 (33%), Positives = 44/81 (53%), Gaps = 4/81 (4%)
 Frame = +3

Query: 362 FKDQWFWRVRNNRVMDGYPMQITYFWRGLP-PSID-AVYENSEGNFVFFKSNKFWVFKDT 419
           FK   +W  R   +  GYP  +T +  G+P   ID A++    G+  FF+ +++W F + 
Sbjct: 108 FKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEE 287

Query: 420 TLQ--PGYPHDLITLGSGIPS 438
           T +  PGYP   I++  GIP+
Sbjct: 288 TQRGDPGYPKP-ISVWQGIPA 347
>ref|NM_010810.1| Mus musculus matrix metalloproteinase 7 (Mmp7), mRNA
          Length = 1072

 Score =  169 bits (429), Expect = 6e-40
 Identities = 93/246 (37%), Positives = 127/246 (50%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL    P  S  +   ++   +  MQ+F+G+ MTGK+    ++ M+KPRCGVPD
Sbjct: 143 WEQAQNYLRKFYPHDSKTKKVNSLVDNLKEMQKFFGLPMTGKLSPYIMEIMQKPRCGVPD 322

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  + + Y I + T  +      + +++A  +W    PL
Sbjct: 323 VAEYSLMPN---------SPKWHSRIVTYRIVSYTSDLPRIVVDQIVKKALRMWSMQIPL 475

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F+ V +          DI I FA   HGDS PFDG G  L HA+ PGPG+GGD HFD D
Sbjct: 476 NFKRVSW-------GTADIIIGFARRDHGDSFPFDGPGNTLGHAFAPGPGLGGDAHFDKD 634

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT  +    G +    A HE GH+LGL HS+ P  +M P YQ   +++F L  DD+ G
Sbjct: 635 EYWT--DDEDAGVNFLFAATHEFGHSLGLSHSSVPGTVMYPTYQRDYSEDFSLTKDDIAG 808

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 809 IQKLYG 826
>gb|L36244.1|MUSMAT Mus musculus metalloproteinase matrilysin mRNA, complete cds
          Length = 1072

 Score =  169 bits (429), Expect = 6e-40
 Identities = 93/246 (37%), Positives = 127/246 (50%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL    P  S  +   ++   +  MQ+F+G+ MTGK+    ++ M+KPRCGVPD
Sbjct: 143 WEQAQNYLRKFYPHDSKTKKVNSLVDNLKEMQKFFGLPMTGKLSPYIMEIMQKPRCGVPD 322

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
               S   N           KW  + + Y I + T  +      + +++A  +W    PL
Sbjct: 323 VAEYSLMPN---------SPKWHSRIVTYRIVSYTSDLPRIVVDQIVKKALRMWSMQIPL 475

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
            F+ V +          DI I FA   HGDS PFDG G  L HA+ PGPG+GGD HFD D
Sbjct: 476 NFKRVSW-------GTADIIIGFARRDHGDSFPFDGPGNTLGHAFAPGPGLGGDAHFDKD 634

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E WT  +    G +    A HE GH+LGL HS+ P  +M P YQ   +++F L  DD+ G
Sbjct: 635 EYWT--DDEDAGVNFLFAATHEFGHSLGLSHSSVPGTVMYPTYQRDYSEDFSLTKDDIAG 808

Query: 286 IQKIYG 291
           IQK+YG
Sbjct: 809 IQKLYG 826
>gb|U04444.1|FDU04444 Felis domesticus PUMP-1 mRNA, partial cds
          Length = 1001

 Score =  167 bits (424), Expect = 2e-39
 Identities = 95/246 (38%), Positives = 129/246 (51%)
 Frame = +2

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL    P  +  R A++  + +  MQ+F+ + +TG +D   I  M++PRCG+PD
Sbjct: 80  WKQAQEYLKRFYPSDAKSRDADSFGAQLKEMQKFFRLPVTGMLDSRVIVVMQQPRCGLPD 259

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPL 165
                   N           KW  K + Y I + T  +        + +A ++W    PL
Sbjct: 260 TGEDLPSRN---------RPKWISKVVTYRIISYTRDLPRVTVDHLVAKALNMWSKEIPL 412

Query: 166 TFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD 225
           +F  V            DI I FA G HGD  PFDG GG LAHAY PGPG+GGD HFD D
Sbjct: 413 SFRRVVL-------GIPDIVIGFARGAHGDFYPFDGPGGTLAHAYEPGPGLGGDAHFDED 571

Query: 226 EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           E W  G     G +   VA HELGH+LGL HS+DP ++M P Y   +++NFKL   D++ 
Sbjct: 572 ERWADGRGL--GINFLAVATHELGHSLGLRHSSDPDSVMYPTYGARDSENFKLSPGDIRE 745

Query: 286 IQKIYG 291
           IQ++YG
Sbjct: 746 IQELYG 763
>ref|NM_071389.1| Caenorhabditis elegans
          Length = 1740

 Score =  166 bits (419), Expect = 8e-39
 Identities = 110/266 (41%), Positives = 139/266 (51%), Gaps = 20/266 (7%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSV------LRSAETM-QSAIAAMQQFYGINMTGKVDRNTIDWMKK 98
           +LQ +GY+PP++   S       ++SAE + +SAI   Q+F GI  TG +D  T   M  
Sbjct: 178 YLQTFGYVPPSNSLQSRNGMAGDIQSAEQVFKSAIRKFQEFAGIAKTGFLDAATKAKMAL 357

Query: 99  PRCGVPDQ----TRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRR 154
            RCGV D     T GSS+F            KW    + YSI++ +  +   + R+AI  
Sbjct: 358 SRCGVTDAPLALTSGSSQF------------KWSKTRLTYSIESWSSDLSKDDVRRAISE 501

Query: 155 AFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGP 214
           A+ +W  VTPL F EVP           DI I F    H D  PFDGEGG LAHA  P  
Sbjct: 502 AYGLWSKVTPLEFSEVP------AGSTSDIKIRFGVRNHNDPWPFDGEGGVLAHATMPES 663

Query: 215 GIGGDTHFDSDEPWTLGNP----NHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQY 270
           G+    HFD DE WT  +     N++  DL  VA+HE GH LGLEHS D  AIMAPFYQ 
Sbjct: 664 GM---FHFDDDENWTYKDARKIHNNEATDLLAVAIHEGGHTLGLEHSRDENAIMAPFYQK 834

Query: 271 M--ETDNFKLPN---DDLQGIQKIYG 291
               + N+  PN   DD+  IQ IYG
Sbjct: 835 TTDSSGNYVYPNLKSDDISAIQAIYG 912
>dbj|AB007815.1|AB007815 Caenorhabditis elegans mRNA for matrix metalloproteinase, complete
           cds
          Length = 1766

 Score =  166 bits (419), Expect = 8e-39
 Identities = 110/266 (41%), Positives = 139/266 (51%), Gaps = 20/266 (7%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSV------LRSAETM-QSAIAAMQQFYGINMTGKVDRNTIDWMKK 98
           +LQ +GY+PP++   S       ++SAE + +SAI   Q+F GI  TG +D  T   M  
Sbjct: 184 YLQTFGYVPPSNSLQSRNGMAGDIQSAEQVFKSAIRKFQEFAGIAKTGFLDAATKAKMAL 363

Query: 99  PRCGVPDQ----TRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRR 154
            RCGV D     T GSS+F            KW    + YSI++ +  +   + R+AI  
Sbjct: 364 SRCGVTDAPLALTSGSSQF------------KWSKTRLTYSIESWSSDLSKDDVRRAISE 507

Query: 155 AFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGP 214
           A+ +W  VTPL F EVP           DI I F    H D  PFDGEGG LAHA  P  
Sbjct: 508 AYGLWSKVTPLEFSEVP------AGSTSDIKIRFGVRNHNDPWPFDGEGGVLAHATMPES 669

Query: 215 GIGGDTHFDSDEPWTLGNP----NHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQY 270
           G+    HFD DE WT  +     N++  DL  VA+HE GH LGLEHS D  AIMAPFYQ 
Sbjct: 670 GM---FHFDDDENWTYKDARKIHNNEATDLLAVAIHEGGHTLGLEHSRDENAIMAPFYQK 840

Query: 271 M--ETDNFKLPN---DDLQGIQKIYG 291
               + N+  PN   DD+  IQ IYG
Sbjct: 841 TTDSSGNYVYPNLKSDDISAIQAIYG 918
>ref|XM_017384.1| Homo sapiens matrix metalloproteinase 7 (matrilysin, uterine)
           (MMP7), mRNA
          Length = 1120

 Score =  135 bits (339), Expect(2) = 8e-38
 Identities = 68/142 (47%), Positives = 87/142 (60%)
 Frame = +1

Query: 150 KAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHA 209
           + + +A ++W    PL F +V +          DI I FA G HGDS PFDG G  LAHA
Sbjct: 427 RLVSKALNMWGKEIPLHFRKVVW-------GTADIMIGFARGAHGDSYPFDGPGNTLAHA 585

Query: 210 YFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ 269
           + PG G+GGD HFD DE WT G+    G +    A HELGH+LG+ HS+DP A+M P Y 
Sbjct: 586 FAPGTGLGGDAHFDEDERWTDGSSL--GINFLYAATHELGHSLGMGHSSDPNAVMYPTYG 759

Query: 270 YMETDNFKLPNDDLQGIQKIYG 291
             +  NFKL  DD++GIQK+YG
Sbjct: 760 NGDPQNFKLSQDDIKGIQKLYG 825
 Score = 48.9 bits (115), Expect(2) = 8e-38
 Identities = 28/89 (31%), Positives = 44/89 (48%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q   YL       S  ++A ++++ +  MQ+F+G+ +TG ++   I+ M+KPRCGVPD
Sbjct: 141 WEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPD 320

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAY 134
               S   N           KW  K + Y
Sbjct: 321 VAEYSLFPN---------SPKWTSKVVTY 380
>gb|AF097638.1|AF097638 Canis familiaris matrix metalloproteinase-14 (MMP-14) mRNA, partial
           cds
          Length = 445

 Score =  161 bits (408), Expect = 2e-37
 Identities = 71/143 (49%), Positives = 102/143 (70%), Gaps = 1/143 (0%)
 Frame = +3

Query: 398 YENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
           YE  +G FVFFK +K WVF + +L+PGYP  +  LG G+P+  ID+A++W   GKTYFF+
Sbjct: 3   YERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFR 182

Query: 458 GDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIK-EKSTGNSTKML 516
           G++Y+R+ EE+R++D  YPK I +W+GIPESP+G+F+  +  FTYF K  K    + + L
Sbjct: 183 GNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKL 362

Query: 517 RVEPGYPRSILKDFMGCDGPTDR 539
           +VEPGYP+S L+D+MGC     R
Sbjct: 363 KVEPGYPKSALRDWMGCPSSGSR 431
 Score = 67.4 bits (163), Expect = 4e-09
 Identities = 44/132 (33%), Positives = 66/132 (49%), Gaps = 5/132 (3%)
 Frame = +3

Query: 362 FKDQWFWRVRNNRVMDGYPMQITYFWRGLP-PSID-AVYENSEGNFVFFKSNKFWVFKD- 418
           FK    W      +  GYP  I    RGLP   ID A++    G   FF+ NK++ F + 
Sbjct: 33  FKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEE 212

Query: 419 -TTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPK 477
              +   YP + I +  GIP     S +  ++V  TYF+KG++YW++  +   ++PGYPK
Sbjct: 213 LRAVDSEYPKN-IKVWEGIPESPRGSFMGSDEV-FTYFYKGNKYWKFNNQKLKVEPGYPK 386

Query: 478 -PITIWKGIPES 488
             +  W G P S
Sbjct: 387 SALRDWMGCPSS 422
>gb|AF267159.1|AF267159 Ovis aries gelatinase A mRNA, partial cds
          Length = 744

 Score =  157 bits (397), Expect = 3e-36
 Identities = 93/250 (37%), Positives = 125/250 (49%), Gaps = 3/250 (1%)
 Frame = +1

Query: 220 THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
           +++D D  W  G     G  LFLVA HE GHA+GLEHS DP A+MAP Y Y  T NF+L 
Sbjct: 94  SNYDDDRKW--GFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLS 261

Query: 280 NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
           +DD+QGIQ++YG                   ++ P                         
Sbjct: 262 HDDIQGIQELYGASPDIDTGTGPTP------TLGPVT----------------------- 354

Query: 340 AKPNIC--DGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAV 397
             P +C  D  F+ +  +R E+F FKD++ WR    R     P+ +  FW  LP  IDAV
Sbjct: 355 --PELCKQDIVFDGISQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAV 528

Query: 398 YEN-SEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
           YE+  E   VFF  N++WV+  +TL+ GYP  L +LG       +D+A  W    KTY F
Sbjct: 529 YEDPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIF 708

Query: 457 KGDRYWRYGE 466
            GD++WRY E
Sbjct: 709 AGDKFWRYNE 738
 Score = 39.7 bits (91), Expect = 0.88
 Identities = 32/103 (31%), Positives = 43/103 (41%), Gaps = 3/103 (2%)
 Frame = +1

Query: 403 GNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYW 462
           G   FFK    W       +P  P  + T    +P   ID+        K  FF G+ YW
Sbjct: 406 GEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEK-IDAVYEDPQEEKAVFFAGNEYW 582

Query: 463 RYGEEMRSMDPGYPKPITIWKGIPESPQ---GAFVHKENGFTY 502
            Y     +++ GYPKP+T   G+P   Q    AF   +N  TY
Sbjct: 583 VYSAS--TLERGYPKPLTS-LGLPPDVQKVDAAFNWSKNKKTY 702
>gb|AF134714.1|AF134714 Bos taurus MMP-1 protein mRNA, partial cds
          Length = 524

 Score =  153 bits (387), Expect = 4e-35
 Identities = 79/165 (47%), Positives = 102/165 (60%)
 Frame = +3

Query: 127 WQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITI 186
           W++ ++ Y I+N TP +  A+  +AI +AF +W NVTPLTF +V        +   DI I
Sbjct: 39  WENTNLTYRIENYTPDLSRADVDQAIEKAFQLWSNVTPLTFTKV-------SEGQADIMI 197

Query: 187 IFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVH 246
            F  G H D+SPFDG GG LAHA+ PG GIGGD HFD DE WT    N    +L+ VA H
Sbjct: 198 SFVRGDHRDNSPFDGPGGNLAHAFQPGAGIGGDAHFDDDEWWT---SNFQDYNLYRVAAH 368

Query: 247 ELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           E GH+LGL HS D  A+M P Y +  + + +L  DD+ GIQ IYG
Sbjct: 369 EFGHSLGLAHSTDIGALMYPSYTF--SGDVQLSQDDIDGIQAIYG 497
>gb|AF156935.1|AF156935 Synthetic construct stromelysin catalytic domain (S1CD) gene,
           partial cds
          Length = 525

 Score =  152 bits (383), Expect = 1e-34
 Identities = 78/167 (46%), Positives = 98/167 (57%), Gaps = 1/167 (0%)
 Frame = +1

Query: 126 KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDIT 185
           KW+  H+ Y I N TP +       A+ +A  VW+ VTPLTF  +        + + DI 
Sbjct: 25  KWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLY-------EGEADIM 183

Query: 186 IIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAV 245
           I FA   HGD  PFDG G  LAHAY PGPGI GD HFD DE WT    +  G +LFLVA 
Sbjct: 184 ISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWT---KDTTGTNLFLVAA 354

Query: 246 HELGHALGLEHSNDPTAIMAPFYQYM-ETDNFKLPNDDLQGIQKIYG 291
           HE+GH+LGL HS +  A+M P Y  + +   F+L  DD+ GIQ +YG
Sbjct: 355 HEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYG 495
>gb|AF149850.1|AF149850 Canis familiaris matrix metalloproteinase-13 mRNA, partial cds
          Length = 590

 Score =  150 bits (378), Expect = 5e-34
 Identities = 93/243 (38%), Positives = 118/243 (48%), Gaps = 2/243 (0%)
 Frame = +3

Query: 151 AIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAY 210
           A ++AF VW +VTPL F       L +G    DI I F +  HGD  PFDG  G LAHA+
Sbjct: 3   AFKKAFKVWSDVTPLNFTR-----LHDGT--ADIMISFGTKEHGDFYPFDGPSGLLAHAF 161

Query: 211 FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQY 270
            PGP  GGD HFD DE WT  +    G +LFLVA HE GH+LGL+HS DP A+M P Y Y
Sbjct: 162 PPGPNYGGDAHFDDDETWTSSSK---GYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTY 332

Query: 271 METDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXX 330
               +F LP+DD+QGIQ +YG                                       
Sbjct: 333 TGKSHFMLPDDDVQGIQSLYG------------------------------------PGD 404

Query: 331 XXXXXSYPGAKPNICDG--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWR 388
                 +P   P+ CD   + + +  LR E  +FKD++FWR+   +V D        FW 
Sbjct: 405 EDPNPRHP-KTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQV-DAELFLTKSFWP 578

Query: 389 GLP 391
            LP
Sbjct: 579 ELP 587
>emb|AL133448.4|CNS01DV2 Human chromosome 14 DNA sequence *** IN PROGRESS *** BAC R-413B13 of
              library RPCI-11 from chromosome 14 of Homo sapiens (Human),
              complete sequence
          Length = 173803

 Score =  147 bits (372), Expect = 2e-33
 Identities = 68/104 (65%), Positives = 81/104 (77%), Gaps = 1/104 (0%)
 Frame = +2

Query: 135    SIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFH 193
              SI+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I FA GFH
Sbjct: 137627 SIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFH 137806

Query: 194    GDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
              GDS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +G
Sbjct: 137807 GDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNG 137938
 Score =  123 bits (308), Expect = 6e-26
 Identities = 69/182 (37%), Positives = 94/182 (50%), Gaps = 46/182 (25%)
 Frame = +3

Query: 362    FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSN---------- 411
              F+++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE  +G FVFFK N          
Sbjct: 139584 FQERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGNQALHFSLWE* 139763

Query: 412    ------------------------------KFWVFKDTTLQPGYPHDLITLGSGIPSHGI 441
                                            K WVF + +L+PGYP  +  LG G+P+  I
Sbjct: 139764 GGSP*RS*FPLKSLEPKLNPDVALLSSPGDKHWVFDEASLEPGYPKHIKELGRGLPTDKI 139943

Query: 442    DSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP-KP-----ITIWKGIPESPQGAFVH 495
              D+A++W   GKTYFF+G++      ++  + PG P KP      ++ +  P  PQ A + 
Sbjct: 139944 DAALFWMPNGKTYFFRGNK-----*DLNPLTPGLPQKPPPPQIPSVLEKDPLYPQHASLE 140108

Query: 496    KE 497
              KE
Sbjct: 140109 KE 140114
 Score = 99.4 bits (246), Expect = 9e-19
 Identities = 50/88 (56%), Positives = 62/88 (69%), Gaps = 9/88 (10%)
 Frame = +1

Query: 213    GPGIGGDTHFDSDEPWTLGN---------PNHDGNDLFLVAVHELGHALGLEHSNDPTAI 263
              G  +GG+T     E   L           P   GND+FLVAVHELGHALGLEHS+DP+AI
Sbjct: 138376 GSRLGGETKAAGGEAGRLREGTQAAIVTVPILPGNDIFLVAVHELGHALGLEHSSDPSAI 138555

Query: 264    MAPFYQYMETDNFKLPNDDLQGIQKIYG 291
              MAPFYQ+M+T+NF LP+DD +GIQ++YG
Sbjct: 138556 MAPFYQWMDTENFVLPDDDRRGIQQLYG 138639
 Score = 83.6 bits (205), Expect = 5e-14
 Identities = 47/111 (42%), Positives = 69/111 (61%), Gaps = 2/111 (1%)
 Frame = +1

Query: 500    FTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDN 558
              FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   III++D 
Sbjct: 140929 FTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDE 141102

Query: 559    TAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
                   V A A+V+P +L L +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 141103 EGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 141255
 Score = 64.7 bits (156), Expect = 3e-08
 Identities = 27/52 (51%), Positives = 40/52 (76%)
 Frame = +3

Query: 42     NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTI 93
              +++ WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+
Sbjct: 136701 SLQAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTM 136856
 Score = 56.2 bits (134), Expect = 9e-06
 Identities = 22/44 (50%), Positives = 33/44 (75%)
 Frame = +2

Query: 456    FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENG 499
              F   RY+R+ EE+R++D  YPK I +W+GIPESP+G+F+  + G
Sbjct: 140456 FPFPRYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEG 140587
 Score = 55.5 bits (132), Expect = 2e-05
 Identities = 22/39 (56%), Positives = 28/39 (71%)
 Frame = +3

Query: 96     MKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAY 134
              M++PRCGVPD+     K N+RRKRYA+ G KWQH  I +
Sbjct: 137136 MRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITF 137252
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = +1

Query: 338    PGAKPNICDGNFNTLVILRREMFVFK 363
              P   PNICDGNF+T+ +LR EMFVFK
Sbjct: 139012 PTYGPNICDGNFDTVAMLRGEMFVFK 139089
>emb|AL135998.6|CNS01DVO Human chromosome 14 DNA sequence BAC R-137H15 of library RPCI-11 from
             chromosome 14 of Homo sapiens (Human), complete sequence
          Length = 165871

 Score =  147 bits (372), Expect = 2e-33
 Identities = 68/104 (65%), Positives = 81/104 (77%), Gaps = 1/104 (0%)
 Frame = -1

Query: 135   SIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFH 193
             SI+N TPKVG+  T +AIR+AF VW++ TPL F EVPY  +  G ++  DI I FA GFH
Sbjct: 62776 SIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFH 62597

Query: 194   GDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
             GDS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +G
Sbjct: 62596 GDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNG 62465
 Score =  123 bits (308), Expect = 6e-26
 Identities = 69/182 (37%), Positives = 94/182 (50%), Gaps = 46/182 (25%)
 Frame = -2

Query: 362   FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFVFFKSN---------- 411
             F+++WFWRVRNN+VMDGYPM I  FWRGLP SI+  YE  +G FVFFK N          
Sbjct: 60819 FQERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGNQALHFSLWE* 60640

Query: 412   ------------------------------KFWVFKDTTLQPGYPHDLITLGSGIPSHGI 441
                                           K WVF + +L+PGYP  +  LG G+P+  I
Sbjct: 60639 GGSP*RS*FPLKSLEPKLNPDVALLSSPGDKHWVFDEASLEPGYPKHIKELGRGLPTDKI 60460

Query: 442   DSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYP-KP-----ITIWKGIPESPQGAFVH 495
             D+A++W   GKTYFF+G++      ++  + PG P KP      ++ +  P  PQ A + 
Sbjct: 60459 DAALFWMPNGKTYFFRGNK-----*DLNPLTPGLPQKPPPPQIPSVLEKDPLYPQHASLE 60295

Query: 496   KE 497
             KE
Sbjct: 60294 KE 60289
 Score = 99.4 bits (246), Expect = 9e-19
 Identities = 50/88 (56%), Positives = 62/88 (69%), Gaps = 9/88 (10%)
 Frame = -3

Query: 213   GPGIGGDTHFDSDEPWTLGN---------PNHDGNDLFLVAVHELGHALGLEHSNDPTAI 263
             G  +GG+T     E   L           P   GND+FLVAVHELGHALGLEHS+DP+AI
Sbjct: 62027 GSRLGGETKAAGGEAGRLREGTQAAIVTVPILPGNDIFLVAVHELGHALGLEHSSDPSAI 61848

Query: 264   MAPFYQYMETDNFKLPNDDLQGIQKIYG 291
             MAPFYQ+M+T+NF LP+DD +GIQ++YG
Sbjct: 61847 MAPFYQWMDTENFVLPDDDRRGIQQLYG 61764
 Score = 83.6 bits (205), Expect = 5e-14
 Identities = 47/111 (42%), Positives = 69/111 (61%), Gaps = 2/111 (1%)
 Frame = -3

Query: 500   FTYFIK-EKSTGNSTKMLRVEPGYPRSILKDFMGCDGPTDRDKDRHSPQDDVDIIIKLDN 558
             FTYF K  K    + + L+VEPGYP+S L+D+MGC  P+    D  + ++   III++D 
Sbjct: 59474 FTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC--PSGGRPDEGTEEETEVIIIEVDE 59301

Query: 559   TAS-TVKAIAIVIPCILALCLLVLVYTVFQFKREGTPRHILYCKRSMQEWV 608
                  V A A+V+P +L L +L +   VF F+R GTPR +LYC+RS+ + V
Sbjct: 59300 EGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 59148
 Score = 64.7 bits (156), Expect = 3e-08
 Identities = 27/52 (51%), Positives = 40/52 (76%)
 Frame = -2

Query: 42    NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTI 93
             +++ WLQ+YGYLPP D R    RS +++ +AIAAMQ+FYG+ +TGK D +T+
Sbjct: 63702 SLQAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTM 63547
 Score = 56.2 bits (134), Expect = 9e-06
 Identities = 22/44 (50%), Positives = 33/44 (75%)
 Frame = -1

Query: 456   FKGDRYWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENG 499
             F   RY+R+ EE+R++D  YPK I +W+GIPESP+G+F+  + G
Sbjct: 59947 FPFPRYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEG 59816
 Score = 55.5 bits (132), Expect = 2e-05
 Identities = 22/39 (56%), Positives = 28/39 (71%)
 Frame = -2

Query: 96    MKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAY 134
             M++PRCGVPD+     K N+RRKRYA+ G KWQH  I +
Sbjct: 63267 MRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITF 63151
 Score = 42.0 bits (97), Expect = 0.18
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = -3

Query: 338   PGAKPNICDGNFNTLVILRREMFVFK 363
             P   PNICDGNF+T+ +LR EMFVFK
Sbjct: 61391 PTYGPNICDGNFDTVAMLRGEMFVFK 61314
>gb|AF248646.1|AF248646 Homo sapiens matrix metalloproteinase-26 precursor (MMP26) mRNA,
           complete cds
          Length = 999

 Score =  142 bits (358), Expect = 1e-31
 Identities = 85/224 (37%), Positives = 118/224 (51%)
 Frame = +1

Query: 68  TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKW 127
           T ++    +QQF+  N T  +D      + +P CGVPD     S  +I   R      KW
Sbjct: 157 TQETQTQLLQQFHR-NGTDLLDMQMHALLHQPHCGVPD----GSDTSISPGRC-----KW 306

Query: 128 QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
               + Y I N    +  +  + +I  A  +W NVTPL F++V     +NG  D DI + 
Sbjct: 307 NKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQV-----QNG--DADIKVS 465

Query: 188 FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHE 247
           F    H D  PFDG GG L HA+ P  G  G  HFD +E W+  +    G +LFLVA HE
Sbjct: 466 FWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDT---GYNLFLVATHE 636

Query: 248 LGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           +GH+LGL+HS + ++IM P Y Y +   F+L  DD+Q IQ +YG
Sbjct: 637 IGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYG 768
>ref|XM_051704.1| Homo sapiens matrix metalloproteinase 26 (MMP26), mRNA
          Length = 989

 Score =  142 bits (358), Expect = 1e-31
 Identities = 85/224 (37%), Positives = 118/224 (51%)
 Frame = +1

Query: 68  TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKW 127
           T ++    +QQF+  N T  +D      + +P CGVPD     S  +I   R      KW
Sbjct: 166 TQETQTQLLQQFHR-NGTDLLDMQMHALLHQPHCGVPD----GSDTSISPGRC-----KW 315

Query: 128 QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
               + Y I N    +  +  + +I  A  +W NVTPL F++V     +NG  D DI + 
Sbjct: 316 NKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQV-----QNG--DADIKVS 474

Query: 188 FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHE 247
           F    H D  PFDG GG L HA+ P  G  G  HFD +E W+  +    G +LFLVA HE
Sbjct: 475 FWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDT---GYNLFLVATHE 645

Query: 248 LGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           +GH+LGL+HS + ++IM P Y Y +   F+L  DD+Q IQ +YG
Sbjct: 646 IGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYG 777
>ref|NM_021801.2| Homo sapiens matrix metalloproteinase 26 (MMP26), mRNA
          Length = 1009

 Score =  142 bits (358), Expect = 1e-31
 Identities = 85/224 (37%), Positives = 118/224 (51%)
 Frame = +1

Query: 68  TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKW 127
           T ++    +QQF+  N T  +D      + +P CGVPD     S  +I   R      KW
Sbjct: 166 TQETQTQLLQQFHR-NGTDLLDMQMHALLHQPHCGVPD----GSDTSISPGRC-----KW 315

Query: 128 QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
               + Y I N    +  +  + +I  A  +W NVTPL F++V     +NG  D DI + 
Sbjct: 316 NKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQV-----QNG--DADIKVS 474

Query: 188 FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHE 247
           F    H D  PFDG GG L HA+ P  G  G  HFD +E W+  +    G +LFLVA HE
Sbjct: 475 FWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDT---GYNLFLVATHE 645

Query: 248 LGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           +GH+LGL+HS + ++IM P Y Y +   F+L  DD+Q IQ +YG
Sbjct: 646 IGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYG 777
>gb|AF022427.1|MM14MMP4 Mus musculus matrix metalloproteinase-14 (Mmp14), exon 4
          Length = 555

 Score =  142 bits (358), Expect = 1e-31
 Identities = 65/104 (62%), Positives = 79/104 (75%), Gaps = 1/104 (0%)
 Frame = +2

Query: 135 SIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENG-KRDVDITIIFASGFH 193
           SI+N T K G+  T + IR+AF VW++ TPL F EVPY  +  G ++  DI I+FA GFH
Sbjct: 29  SIQNYTSKXGEXXTFEXIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFH 208

Query: 194 GDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDG 237
           GDS+PFDGEGGFLAHAYFPGP IGGDTHFDS EPWT+ N + +G
Sbjct: 209 GDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNG 340
>gb|AF291664.1|AF291664 Homo sapiens matrix metalloproteinase-26 (MMP26) mRNA, complete cds
          Length = 998

 Score =  142 bits (358), Expect = 1e-31
 Identities = 85/224 (37%), Positives = 118/224 (51%)
 Frame = +1

Query: 68  TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKW 127
           T ++    +QQF+  N T  +D      + +P CGVPD     S  +I   R      KW
Sbjct: 166 TQETQTQLLQQFHR-NGTDLLDMQMHALLHQPHCGVPD----GSDTSISPGRC-----KW 315

Query: 128 QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
               + Y I N    +  +  + +I  A  +W NVTPL F++V     +NG  D DI + 
Sbjct: 316 NKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQV-----QNG--DADIKVS 474

Query: 188 FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHE 247
           F    H D  PFDG GG L HA+ P  G  G  HFD +E W+  +    G +LFLVA HE
Sbjct: 475 FWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDT---GYNLFLVATHE 645

Query: 248 LGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           +GH+LGL+HS + ++IM P Y Y +   F+L  DD+Q IQ +YG
Sbjct: 646 IGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYG 777
>emb|AJ251531.1|HSA251531 Homo sapiens mRNA for matrilysin-2 (MMP26 gene)
          Length = 995

 Score =  142 bits (358), Expect = 1e-31
 Identities = 85/224 (37%), Positives = 118/224 (51%)
 Frame = +1

Query: 68  TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKW 127
           T ++    +QQF+  N T  +D      + +P CGVPD     S  +I   R      KW
Sbjct: 163 TQETQTQLLQQFHR-NGTDLLDMQMHALLHQPHCGVPD----GSDTSISPGRC-----KW 312

Query: 128 QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
               + Y I N    +  +  + +I  A  +W NVTPL F++V     +NG  D DI + 
Sbjct: 313 NKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQV-----QNG--DADIKVS 471

Query: 188 FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHE 247
           F    H D  PFDG GG L HA+ P  G  G  HFD +E W+  +    G +LFLVA HE
Sbjct: 472 FWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDT---GYNLFLVATHE 642

Query: 248 LGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           +GH+LGL+HS + ++IM P Y Y +   F+L  DD+Q IQ +YG
Sbjct: 643 IGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYG 774
>gb|AF230354.1|AF230354 Homo sapiens matrix metalloproteinase MMP-26 mRNA, complete cds
          Length = 994

 Score =  141 bits (356), Expect = 2e-31
 Identities = 85/224 (37%), Positives = 118/224 (51%)
 Frame = +3

Query: 68  TMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKW 127
           T ++    +QQF+  N T  +D      + +P CGVPD     S  +I   R      KW
Sbjct: 153 TQETQTQLLQQFHR-NGTDLLDIQMHALLHQPHCGVPD----GSDTSISPGRC-----KW 302

Query: 128 QHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
               + Y I N    +  +  + +I  A  +W NVTPL F++V     +NG  D DI + 
Sbjct: 303 NKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQV-----QNG--DADIKVS 461

Query: 188 FASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHE 247
           F    H D  PFDG GG L HA+ P  G  G  HFD +E W+  +    G +LFLVA HE
Sbjct: 462 FWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDT---GYNLFLVATHE 632

Query: 248 LGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           +GH+LGL+HS + ++IM P Y Y +   F+L  DD+Q IQ +YG
Sbjct: 633 IGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYG 764
>gb|U63725.1|GMU63725 Glycine max metalloproteinase mRNA, complete cds
          Length = 1196

 Score =  139 bits (349), Expect = 1e-30
 Identities = 99/261 (37%), Positives = 130/261 (48%), Gaps = 11/261 (4%)
 Frame = +3

Query: 42  NVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRC 101
           NV+ +    GY+P   P        +T+ SAI   Q+ Y +N+TGK D NT+  +  PRC
Sbjct: 210 NVKNYFHHLGYIPNA-PHFDD-NFDDTLVSAIKTYQKNYNLNVTGKFDINTLKQIMTPRC 383

Query: 102 GVPD---QTRGSSKFN-IRRKRYALTGQKWQ--HKHIAYSIKNVTPKVGDAETRKAIRRA 155
           GVPD    T  ++ F  I    +     +WQ     + Y+  +  P++ D   + AI RA
Sbjct: 384 GVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAF-SPEPRLDDT-FKSAIARA 557

Query: 156 FDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPG 215
           F  W  V  + F+E    E  N      I I+FAS  HGD  PFDG GG L HA+ P   
Sbjct: 558 FSKWTPVVNIAFQETTSYETAN------IKILFASKNHGDPYPFDGPGGILGHAFAP--- 710

Query: 216 IGGDTHFDSDEPWTLG-----NPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQY 270
             G  HFD+DE W        +P     DL  VAVHE+GH LGL HS+D  AIM P    
Sbjct: 711 TDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIP- 887

Query: 271 METDNFKLPNDDLQGIQKIYG 291
             T    L  DD+ GI+K+YG
Sbjct: 888 PRTRKVNLAQDDIDGIRKLYG 950
>emb|X76537.1|MMSROM2 Mus musculus mRNA for stromelysin-2
          Length = 683

 Score =  138 bits (348), Expect = 1e-30
 Identities = 86/257 (33%), Positives = 128/257 (49%), Gaps = 4/257 (1%)
 Frame = +3

Query: 228 WTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETD-NFKLPNDDLQGI 286
           WTL      G +LFLVA HELGH+LGL HS+   ++M P Y++  +  NF L  DD++GI
Sbjct: 3   WTLAP---SGTNLFLVAAHELGHSLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIEGI 173

Query: 287 QKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICD 346
           Q +YG                   S+ P                              CD
Sbjct: 174 QSLYGAGPSSDATVVPVL------SVSPRPETTDK-----------------------CD 266

Query: 347 G--NFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE-NSEG 403
              +F+++  LR E+  FKD++FWR  +      + + I+ FW  LP  +DA YE ++  
Sbjct: 267 PALSFDSVNTLRGEVLFFKDRYFWRRSHWNPEPEFHL-ISAFWPTLPSDLDAAYEAHNTD 443

Query: 404 NFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWR 463
           + + FK ++FW  +   +Q GYP  + TLG       ID+A++ ++  KTYFF GD+YWR
Sbjct: 444 SVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWR 623

Query: 464 YGEEMRSMDPGYPKPIT 480
           + E    MD G+P+ IT
Sbjct: 624 FDETRHVMDKGFPRQIT 674
>dbj|AB031324.1|AB031324 Sus scrofa mRNA for matrilysin-related protein, complete cds
          Length = 1198

 Score =  138 bits (347), Expect = 2e-30
 Identities = 71/159 (44%), Positives = 94/159 (58%)
 Frame = +2

Query: 133 AYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGF 192
           A  I + T  +      + + +A  +W N  PL+F++V +          DI I FA G 
Sbjct: 422 ATRIVSYTRDLPHVTVNQLVTKALKMWSNEIPLSFKKVSW-------GIADIIIGFARGA 580

Query: 193 HGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHAL 252
           HGD+ PFDG G  LAHA+ PGPG+GGD HFD DE W+ G     G +    A HELGH+L
Sbjct: 581 HGDAYPFDGPGNTLAHAFAPGPGLGGDAHFDEDEHWSDG--GSIGINFLYAATHELGHSL 754

Query: 253 GLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           GL HS+DP A+M P Y  + + +FKL  DD+ GIQK+YG
Sbjct: 755 GLAHSSDPNAVMYPTYGEVYSKDFKLSQDDINGIQKLYG 871
 Score = 51.6 bits (122), Expect = 2e-04
 Identities = 23/60 (38%), Positives = 37/60 (61%)
 Frame = +3

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           W Q  GYL    P  S  + A ++++ +  MQ+F+ + +TG ++ + I  M+KPRCGVPD
Sbjct: 102 WEQAQGYLKKFYPSNSKTKDANSLEAKLKQMQKFFRLPITGMLNSHIIKIMQKPRCGVPD 281
>dbj|AB057753.1|AB057753 Paralichthys olivaceus MMP9 mRNA for gelatinase, complete cds
          Length = 2802

 Score =  137 bits (344), Expect = 4e-30
 Identities = 75/189 (39%), Positives = 100/189 (52%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+++GYL       S  +S  +   A+  MQ+  G+  TGK+D++T++ MK+PRCGV
Sbjct: 311 ETYLKRFGYLDKM--HRSGFQSMVSTAKALKMMQRQMGLKETGKLDKSTLEAMKQPRCGV 484

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD         +   +      KW H  + Y   N +P +  +    A  RAF VW +VT
Sbjct: 485 PD---------VANYQTFEGDLKWDHNDVTYRTLNYSPDMESSLIDDAFARAFKVWSDVT 637

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PLTF  +        +   DI I F    HGD  PFDG  G LAHAY PG G+ GD HFD
Sbjct: 638 PLTFTRLY-------EGTADIMISFGKADHGDPYPFDGRNGLLAHAYPPGEGVQGDAHFD 796

Query: 224 SDEPWTLGN 232
            DE WTLGN
Sbjct: 797 DDEHWTLGN 823
 Score =  114 bits (284), Expect = 4e-23
 Identities = 82/291 (28%), Positives = 130/291 (44%), Gaps = 5/291 (1%)
 Frame = +2

Query: 221  HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN 280
            ++D D  W  G  + +G  LFLVA HE GHALGL+HSN   A+M P Y Y+E  +F L  
Sbjct: 1310 NYDEDAKW--GFCDDEGYSLFLVAAHEFGHALGLDHSNIREALMYPMYTYVE--DFSLHK 1477

Query: 281  DDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGA 340
            DD++GIQ +YG                     PP                          
Sbjct: 1478 DDIEGIQYLYGRGTGPD-------------PTPPQPTSTTTTPNPTEEPEPTTPQPVDPT 1618

Query: 341  KPNICDGNFNTLVILRREMFVFKDQWFWRV--RNNRVMDGYPMQITYFWRGLPPSIDAVY 398
            +       F+T+ ++  E+  F++  +W++  R +  + G P  ++  W  LP  ID+ +
Sbjct: 1619 RDACKLTKFDTITMIENELHFFENGNYWKMPSRGDGGLKG-PFSLSERWPALPAVIDSAF 1795

Query: 399  EN-SEGNFVFFKSNKFWVF-KDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFF 456
            E+    N  FF  N+FWV+ K+  L    P  +  LG       ++ A+     GK   F
Sbjct: 1796 EDLLTKNMYFFSGNRFWVYTKEGVLG---PRSIEKLGLPTSIQKVEGAL-QRGKGKVLLF 1963

Query: 457  KGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKE 506
              + +W++  + + MD GYPK    ++ G+P      F +K  G  YF ++
Sbjct: 1964 TEESFWKFDLKSQKMDKGYPKSTDYVFGGVPNDAHDVFQYK--GHMYFCRD 2110
>dbj|AB007817.1|AB007817 Caenorhabditis elegans mRNA for matrix metalloproteinase, complete
           cds
          Length = 1736

 Score =  137 bits (344), Expect = 4e-30
 Identities = 127/502 (25%), Positives = 204/502 (40%), Gaps = 14/502 (2%)
 Frame = +1

Query: 46  WLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD 105
           +LQKYGYL   D ++S    +E++  A+  MQ+  G+  TG++D  TI  M++PRCG PD
Sbjct: 127 FLQKYGYLTSGDNQLS----SESLSDALKNMQRMAGLEETGELDERTIQMMERPRCGHPD 294

Query: 106 QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNV--TPKVGDAETRKAIRRAFDVWQNVT 163
                     R KRYA    KW+ K I Y  K V  + ++   + R+ + +A   W  + 
Sbjct: 295 VEDHQKS---RGKRYAPPQFKWKEKIITYGCKAVGTSTRISLDDLRRTMHQAASQWSELA 465

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
            +   E       + K  + +        +  +  FD +   LAHA+FP     G  H +
Sbjct: 466 DVEIVE------SSVKNPMMVISAGRENHYPCTVRFDTKT--LAHAFFP---TNGQIHIN 612

Query: 224 SDEPWTLGNPNH--DGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
               + + N       N L+ V  HE+GHALG  HS D  ++M   + Y     +K  + 
Sbjct: 613 DRVQFAMTNYTERMGANSLYSVVAHEMGHALGFSHSPDIDSVM---FAYDTPRKWKFTSM 783

Query: 282 DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
           D   ++  YG                 +                               +
Sbjct: 784 DKYNMRSYYG----------AKASKKENEEEERKTENEDKRRKTEKDRGRTREHESDDIR 933

Query: 342 PNICDGNFNTLVILRREMFVFKDQWFWRVRNN---RVMDGYPMQITYFWRGLPPSIDAVY 398
           PN C      +V  R E  +FK QW WRV ++    ++   P  I   + GLP  IDA  
Sbjct: 934 PNECRVENPIVVQYRGEYLIFKSQWVWRVSSDWKRLIIKAVP--INQLFPGLPNPIDAAV 1107

Query: 399 ENSEGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGS-GIPSHGIDSAIWWE--DVGKTYF 455
                 +VF     + ++ +  +     H  + L   GI    +D A  W   +    Y 
Sbjct: 1108TVGHNLWVFVGEMIYVIYGNHMV-----HAPLRLSDIGINEKYVDLAYEWHYFNPPAVYI 1272

Query: 456 FKGDRYWRYGEEM--RSMDPGYPKPITI-WKGIPESPQGAFVHKENGFTYFIKEKSTGNS 512
           +KG RYW+  E+M  R +D  YPK   + W  +P+    AF +++        +    NS
Sbjct: 1273WKGSRYWKLDEKMYHRRVDERYPKDTDLNWARVPKGVHSAFTYEKEIHLLRGNQVFRMNS 1452

Query: 513 TK-MLRVEPGYPRSILKDFMGC 533
           ++ +  +  GYP+ +   F  C
Sbjct: 1453SRSVFDIADGYPQPLQSFFGFC 1518
>gb|AF072455.1|AF072455 Xenopus laevis gelatinase B (MMP-9) mRNA, complete cds
          Length = 3451

 Score =  136 bits (342), Expect = 7e-30
 Identities = 79/189 (41%), Positives = 102/189 (53%), Gaps = 1/189 (0%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L ++GYL      +    S  T+Q+A+  MQQ  G+  TG +D  T++ MK+PRCGV
Sbjct: 208 ESYLLQFGYL------IQEQGSNATLQNALTIMQQKLGLKETGVLDAETLEAMKRPRCGV 369

Query: 104 PDQTRGSSKFNIRRKRYALTGQ-KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           PD      +FN         G  KW H  I Y I N +P +       A  RAF VW +V
Sbjct: 370 PD----IGQFN------TFEGDLKWDHNDITYRILNYSPDLDPEVIDDAFARAFKVWSDV 519

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPL+F  +          + DI I+F +  HGD  PFD + G LAHAY PGPG+ GD HF
Sbjct: 520 TPLSFTRIY-------SGEPDINILFGTEDHGDPYPFDRKDGLLAHAYPPGPGVQGDAHF 678

Query: 223 DSDEPWTLG 231
           D DE WTLG
Sbjct: 679 DDDEFWTLG 705
 Score =  103 bits (256), Expect = 6e-20
 Identities = 80/294 (27%), Positives = 131/294 (44%), Gaps = 6/294 (2%)
 Frame = +1

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            +++D D  W  G     G  LFLVA HE GHALGL+HS+   A+M P Y Y++  +F+L 
Sbjct: 1192 SNYDLDSKW--GFCPDQGYSLFLVAAHEFGHALGLDHSDVQDALMYPMYSYVK--DFQLH 1359

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD++GIQ +YG                   + P                        P 
Sbjct: 1360 QDDVRGIQFLYGTGSG---------------APPNPNPPKPTKKPLATKRPRTTTRPVPP 1494

Query: 340  AKP--NICDGN-FNTLVILRREMFVFKDQWFWRVR-NNRVMDGYPMQITYFWRGLPPSID 395
              P  + C+   F+ +  L+  +  FKD  +W +   ++     P++I+  W  LP  ID
Sbjct: 1495 VNPAQDACNVEMFDAIADLQGALHFFKDGLYWTLTPRSKNSPQSPLRISDTWPALPSKID 1674

Query: 396  AVYENSEGNFVFFKS-NKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTY 454
              +++     +FF S +KFW +  T+     P  +  LG       I  + +  D GK  
Sbjct: 1675 TAFQDPTSKSIFFFSGSKFWQYTGTSAIG--PRSIEKLGLSKDVEAIMGS-FARDNGKAL 1845

Query: 455  FFKGDRYWRYGEEMRSMDPGYPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEK 507
             F G++YWR   +  ++D GYP+     + G+P      F+++ N   YF +++
Sbjct: 1846 LFNGEQYWRLNLKTLTIDNGYPRQTADNYPGVPGDSHDVFLYQGN--YYFCQDQ 2001
 Score = 40.0 bits (92), Expect = 0.67
 Identities = 32/135 (23%), Positives = 56/135 (40%), Gaps = 1/135 (0%)
 Frame = +1

Query: 402  EGNFVFFKSNKFWVFKDTTLQ-PGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDR 460
            +G   FFK   +W     +   P  P  +      +PS  ID+A         +FF G +
Sbjct: 1552 QGALHFFKDGLYWTLTPRSKNSPQSPLRISDTWPALPSK-IDTAFQDPTSKSIFFFSGSK 1728

Query: 461  YWRYGEEMRSMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEP 520
            +W+Y     ++ P   + + + K + E+  G+F         F  E+    + K L ++ 
Sbjct: 1729 FWQY-TGTSAIGPRSIEKLGLSKDV-EAIMGSFARDNGKALLFNGEQYWRLNLKTLTIDN 1902

Query: 521  GYPRSILKDFMGCDG 535
            GYPR    ++ G  G
Sbjct: 1903 GYPRQTADNYPGVPG 1947
>gb|AF222690.1|AF222690 Gallus gallus 75 kDa gelatinase mRNA, complete cds
          Length = 2483

 Score =  136 bits (342), Expect = 7e-30
 Identities = 77/189 (40%), Positives = 105/189 (54%), Gaps = 1/189 (0%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L ++GY+   + R S      ++  A+  MQ+  G+  TG++D +T++ M+ PRCGV
Sbjct: 130 ENYLLRFGYIQEAEVRRS--SKHVSLAKALRRMQKQLGLEETGELDASTLEAMRAPRCGV 303

Query: 104 PDQTRGSSKFNIRRKRYALTGQ-KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           PD   G   F          G+ KW H  + Y + N +P +  A    A RRAF VW +V
Sbjct: 304 PD-VGGFLTFE---------GELKWDHMDLTYRVMNYSPDLDRAVIDDAFRRAFKVWSDV 453

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPLTF ++          + DI I+F S  HGD  PFDG+ G LAHA+ PG GI GD HF
Sbjct: 454 TPLTFTQIY-------SGEADIMIMFGSQEHGDGYPFDGKDGLLAHAFPPGSGIQGDAHF 612

Query: 223 DSDEPWTLG 231
           D DE WTLG
Sbjct: 613 DDDEFWTLG 639
 Score =  109 bits (272), Expect = 9e-22
 Identities = 79/284 (27%), Positives = 129/284 (44%), Gaps = 6/284 (2%)
 Frame = +1

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            +++D+D+ W  G     G  +FLVA HE GH+LGL+HS+   A+M P Y Y++  +F+L 
Sbjct: 1126 SNYDTDKKW--GFCPDRGYSIFLVAAHEFGHSLGLDHSSVREALMYPMYSYVQ--DFQLH 1293

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYP- 338
             DD+QGIQ +YG                  +SIP                        P 
Sbjct: 1294 EDDVQGIQYLYGRGSGPEPTPPAPLPTEEPQSIPTEAGSASTTEEEEEETPEPTAEPSPV 1473

Query: 339  -GAKPNICDGNFNTLVILRREMFVFKDQWFWRVRNNRVMDGY--PMQITYFWRGLPPSID 395
              ++    + NF+ +  +  E+  FK+  +W   ++    G      I   W GLP  ID
Sbjct: 1474 DPSRDACMEKNFDAITEINGELHFFKNGKYW-THSSFWKSGTQGAFSIADTWPGLPAVID 1650

Query: 396  AVYENSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTY 454
            A +++     V FF   +FWVF         P  +  LG G  +  I  A+     GK  
Sbjct: 1651 AAFQDVLTKRVFFFAGRQFWVFSGKNAVG--PRRIEKLGIGKEAGRITGAL-QRGRGKVL 1821

Query: 455  FFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKE 497
             F G+ YWR   +++++D GYP+    ++ G+P   +  F++++
Sbjct: 1822 LFSGEHYWRLDVKVQTVDKGYPRDTDDVFTGVPLDARNVFLYQD 1953
>dbj|AB057407.1|AB057407 Cyprinus carpio mRNA for matrix metalloproteinase 9, complete cds
          Length = 2867

 Score =  135 bits (341), Expect = 9e-30
 Identities = 80/189 (42%), Positives = 102/189 (53%)
 Frame = +3

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L++YGY+     + S L++  +   A+  +QQ  G+  TG +D+ TID MK+PRCGV
Sbjct: 279 EEYLKRYGYIDVL--QKSGLQAVVSTSKALMKLQQQLGLEETGSLDQPTIDAMKQPRCGV 452

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD         IR  +      KW H  + Y I N +P +       A  RAF VW +VT
Sbjct: 453 PD---------IRNYQTFEGDLKWDHTDVTYRILNYSPDMEAPLIDDAFARAFKVWSDVT 605

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PLTF       L +G    DI I F    HGD  PFDG+ G L HAY PG GI GD HFD
Sbjct: 606 PLTFTR-----LYDGT--ADIMISFGRENHGDPYPFDGKDGLLVHAYPPGEGIQGDAHFD 764

Query: 224 SDEPWTLGN 232
            DE WTLG+
Sbjct: 765 DDEYWTLGS 791
 Score =  121 bits (304), Expect = 2e-25
 Identities = 81/290 (27%), Positives = 134/290 (45%), Gaps = 3/290 (1%)
 Frame = +3

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            +++D+D+ W  G     G  LFLVA HE GHALGL+HS    A+M P Y+Y+E  +F L 
Sbjct: 1275 SNYDTDKKW--GFCPDKGYSLFLVAAHEFGHALGLDHSKIKDALMYPMYKYIE--DFSLN 1442

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD++GIQ +YG                    +P                      ++ G
Sbjct: 1443 QDDIEGIQYLYGPKTGPNPTPPKPKTTTSSPVVP-------TKPTPSEKTTTVSTTTHVG 1601

Query: 340  AKPNICD-GNFNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVY 398
               + C+   F+ +  +++E+  FKD+ +W++ +N    G P  I+  W  LP +I++ +
Sbjct: 1602 PSQDACEIKEFDAITEIQKELHFFKDRHYWKISSNGERKG-PFFISEKWPALPATINSAF 1778

Query: 399  ENS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFK 457
            E        FF   +FWV+  T  +   P  +  LG       ++  +     GK   F 
Sbjct: 1779 EEPLTKKIYFFADKQFWVY--TGKEVLGPRKIEKLGLPSDLDRVEGTV-QRGKGKVLLFN 1949

Query: 458  GDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKE 506
            G  +W+   + + +D GYP+   +++ G+P      F+HK  GF YF +E
Sbjct: 1950 GVNFWKLDVKAQMIDSGYPRSTDSVFGGVPIDSHDVFLHK--GFFYFCRE 2093
>dbj|D82052.1|D82052 Cynops pyrrhogaster mRNA for gelatinase-b, complete cds
          Length = 3885

 Score =  135 bits (340), Expect = 1e-29
 Identities = 73/189 (38%), Positives = 105/189 (54%), Gaps = 1/189 (0%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+++GY+     + +   +  ++  A+  MQ+  G+N TG++D++T++ MK PRCGV
Sbjct: 209 ESYLERFGYIS----KRARSSTHVSLSKALLQMQKKLGLNETGELDQSTLEAMKTPRCGV 376

Query: 104 PDQTRGSSKFNIRRKRYALTGQ-KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           PD     +            G  KW H  I + + N +P +       A RRAF VW +V
Sbjct: 377 PDVGNFQT----------FDGDLKWDHNDITFRVLNYSPDLDGDVIEDAFRRAFKVWSDV 526

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           +PLTF ++          + DI I+F S  HGD  PFDG+ G LAHAY PG G+ GD HF
Sbjct: 527 SPLTFTQIY-------SGEADIMILFGSDDHGDPYPFDGKDGLLAHAYPPGEGVQGDAHF 685

Query: 223 DSDEPWTLG 231
           D DE WTLG
Sbjct: 686 DDDEFWTLG 712
 Score =  114 bits (285), Expect = 3e-23
 Identities = 92/323 (28%), Positives = 144/323 (44%), Gaps = 11/323 (3%)
 Frame = +2

Query: 222  FDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND 281
            +DSD  W  G     G  LFLV  HE GHA+GLEHS    A+M P ++Y+E   F+L  D
Sbjct: 1205 YDSDRKW--GFCPDQGYSLFLVGAHEFGHAIGLEHSTVRDALMYPMFRYIE--GFQLHQD 1372

Query: 282  DLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAK 341
            D++G+Q +YG                 H S P                      +     
Sbjct: 1373 DIEGVQYLYGSGTGP------------HPSPPMPTTKSPDVSGKTTTTVTTSPTTTTELV 1516

Query: 342  P-----NICDGN-FNTLVILRREMFVFKDQWFWRVRNNR--VMDGYPMQITYFWRGLPPS 393
            P     + C    F+ +  +  ++  FKD  +W+  + R   + G P++I+  W  LP  
Sbjct: 1517 PVDPTTDACKVKAFDAITEIEGQLHFFKDGKYWKASSARPGAIKG-PVKISDTWPALPAI 1693

Query: 394  IDAVYENSEGNFVFFKSNK-FWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGK 452
            ID+ +E+     +FF S + FWV+  TT+    P  L  LG G     I  ++     GK
Sbjct: 1694 IDSAFEDLLTKKIFFFSGRRFWVYTGTTVLG--PRGLEKLGIGKDVEKIVGSLQ-RGRGK 1864

Query: 453  TYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKSTGN 511
               F GD+YWR   + + +D GYP+     + G+P +    F+++EN   +F K++    
Sbjct: 1865 VLLFNGDKYWRLDVKTQVVDKGYPRDTEDAFAGVPINAHDVFLYQEN--IHFCKDQFYWR 2038

Query: 512  STKMLRVEP-GYPRSILKDFMGC 533
             T   +V+  GY   +  D + C
Sbjct: 2039 MTPRRQVDQVGY---VKYDILNC 2098
>dbj|AB033755.1|AB033755 Oryzias latipes gel-b mRNA for gelatinase B, complete cds
          Length = 2803

 Score =  135 bits (339), Expect = 2e-29
 Identities = 78/188 (41%), Positives = 103/188 (54%)
 Frame = +1

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L+K+GY+     + S  +S  +   A+  MQ+  G++ TG++D  T++ MK+PRCGV
Sbjct: 280 ESYLRKFGYMDTF--QRSGFQSLASTSKALKRMQRQLGLDETGQLDMQTLEAMKQPRCGV 453

Query: 104 PDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVT 163
           PD         +   +      KW H  + Y I N +P +  + T  A  RAF VW +VT
Sbjct: 454 PD---------VANYKTFDGDLKWDHGDVTYRILNYSPDLDSSVTDDAFARAFKVWSDVT 606

Query: 164 PLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFD 223
           PLTF       L +G    DI I F    HGD  PFDG+ G LAHAY PG GI GD HFD
Sbjct: 607 PLTFTR-----LFDGT--ADIMISFGKKDHGDLYPFDGKDGLLAHAYPPGEGIQGDAHFD 765

Query: 224 SDEPWTLG 231
            DE WTLG
Sbjct: 766 DDEFWTLG 789
 Score =  121 bits (304), Expect = 2e-25
 Identities = 91/327 (27%), Positives = 139/327 (41%), Gaps = 4/327 (1%)
 Frame = +1

Query: 217  GGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
            G    +D D+ W  G     G  LFLVA HE GHALGL+HSN   A+M P Y Y+E  +F
Sbjct: 1267 GTTASYDDDKKW--GFCPDQGYSLFLVAAHEFGHALGLDHSNIRDALMYPMYSYVE--DF 1434

Query: 277  KLPNDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXS 336
             L  DD++GIQ +YG                   +  P                      
Sbjct: 1435 SLHEDDIEGIQYLYGSKTDPKPTVPQPKPPTTTATPDPDVTDSTDEPEPTNRPATTTLNP 1614

Query: 337  YPGAKPNICDGNFNTLVILRREMFVFKDQWFWRV-RNNRVMDGYPMQITYFWRGLPPSID 395
                K       F+T+ ++  +++ FKD  FWR  R        PM I+  W  LP  ID
Sbjct: 1615 LDPTKDACKVTKFDTITVIGGDLYFFKDGHFWRKSRKGDAALESPMLISERWPALPAVID 1794

Query: 396  AVYENS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTY 454
            + +E+       FF   KFWV+    +    P  +  LG       ++ A+  +   K  
Sbjct: 1795 SAFEDILTKKLYFFSGTKFWVYTGKNVLG--PRSIEKLGLPDSVQKVEGALQ-KGKDKVL 1965

Query: 455  FFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFIKEKSTGNST 513
             F G+ +WR   + + +D GYPK I  ++ G+P      F+++  G T+F +++      
Sbjct: 1966 LFSGENFWRLDVKTQKIDKGYPKYIDVVFGGVPIDAHDVFLYE--GRTFFCRDQFYWRMN 2139

Query: 514  KMLRVE-PGYPRSILKDFMGCDGPTDR 539
               +V+  GY   +  D + C  P+ R
Sbjct: 2140 SRRQVDRVGY---VKYDLLKCTNPSSR 2211
>gb|S75623.1|S75623 collagenase [Rana catesbeiana=bullfrags, stage X tadpoles, back
           skin, mRNA, 1521 nt]
          Length = 1521

 Score =  135 bits (339), Expect = 2e-29
 Identities = 85/215 (39%), Positives = 109/215 (50%), Gaps = 2/215 (0%)
 Frame = +3

Query: 73  IAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALT--GQKWQHK 130
           +  ++QF+G+ +TGK D  T+  MK+  CGVPD              Y LT    +W++ 
Sbjct: 204 VEILKQFFGLKVTGKPDAETLV-MKQSTCGVPDVGE-----------YVLTPGNPRWENT 347

Query: 131 HIAYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFAS 190
           H+ Y I+N TP +                  V+PLTF +V        +   DI I F  
Sbjct: 348 HLTYRIENYTPDL------------------VSPLTFTKV-------SEGQADIMISFVR 452

Query: 191 GFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGH 250
           G H D  PFDG GG LAHA  PGPGIGGD HFD  E WT    N    +L+ VA HELGH
Sbjct: 453 GDHRDKYPFDGPGGNLAHASQPGPGIGGDAHFDEYERWT---KNFQDYNLYRVAAHELGH 623

Query: 251 ALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQG 285
           +LGL HS D  A+M P Y      + +L  DD+ G
Sbjct: 624 SLGLSHSTDIGALMYPTYL---RGDVQLSQDDIDG 719
 Score = 43.9 bits (102), Expect = 0.046
 Identities = 37/137 (27%), Positives = 56/137 (40%), Gaps = 3/137 (2%)
 Frame = +3

Query: 342 PNICDGN--FNTLVILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYE 399
           P +CD    F+ +  +R E+  FK      +R NR           F+  +   + A YE
Sbjct: 759 PQVCDSKLTFDAITTVRGELMFFK------MRTNR-----------FYPEVELGLQAAYE 887

Query: 400 NSEGNFV-FFKSNKFWVFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKG 458
            ++ + V FFK NK+W      +  GYP D+ +      S G  + +  E          
Sbjct: 888 MADRDEVRFFKGNKYWAVSGQDVLYGYPKDIHS------SFGFPTGVAHE---------- 1019

Query: 459 DRYWRYGEEMRSMDPGY 475
              W Y E  +SMD GY
Sbjct: 1020--CWSYDEYKQSMDTGY 1064
>ref|NM_065193.1| protease
          Length = 1560

 Score =  133 bits (335), Expect = 4e-29
 Identities = 87/268 (32%), Positives = 130/268 (48%), Gaps = 23/268 (8%)
 Frame = +1

Query: 47  LQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQ 106
           ++KYGYL   D       S +  + A+   Q+   +  TG VD  T++   KPRC   D 
Sbjct: 184 MEKYGYLKGIDHS-----SPQEFRQALMFFQEVLEVEQTGNVDEMTVEAASKPRCTQTDV 348

Query: 107 TRGSSKFNIRRKRYALTGQ-KWQHKH-----IAYSIKNVTPKVGDAETRKAIRRAFDVWQ 160
            +  +K   R KR+ L+ + KW H       + + I + T  +   ETRK + +AF +W 
Sbjct: 349 RQEQTK---RTKRFTLSKRAKWAHASGQSVTLKWYISDYTSDIDRLETRKVVEKAFKLWS 519

Query: 161 NVTPLTFEEVPYIELE--NGKRDVDITIIFASGFHGDSSPFDGEGG---------FLAHA 209
           + + +  E+   +  +  + K + DI I++A G HGD   FDG  G          LAH 
Sbjct: 520 SQSYIKNEKKVTLTFQEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHT 699

Query: 210 YFPGPG--IGGDTHFDSDEPWTLG--NPNHDGNDLFL--VAVHELGHALGLEHSNDPTAI 263
           +FPG    + GD HFD  E W +      H  N  F   V  HE+GHALGL+HS    A+
Sbjct: 700 FFPGYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADAL 879

Query: 264 MAPFYQYMETDNFKLPNDDLQGIQKIYG 291
           M P+Y+ +  +  +L  DD  G+   YG
Sbjct: 880 MHPYYKNVPINEIQLDIDDKCGVIWNYG 963
>ref|NM_022791.1| Homo sapiens matrix metalloproteinase 19 (MMP19), transcript
           variant rasi-6, mRNA
          Length = 2304

 Score =  133 bits (335), Expect = 4e-29
 Identities = 85/213 (39%), Positives = 118/213 (54%), Gaps = 5/213 (2%)
 Frame = +1

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKV 143
           ++G++D  T   M++PRCG+ D       FN +  +Y L G +W+ KH+ + I N+   +
Sbjct: 247 VSGQLDDATRARMRQPRCGLEDP------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTL 405

Query: 144 GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD-----SSP 198
                R A+R+AF  W NV PLTF+EV     + G  D+ ++      FHG      S+ 
Sbjct: 406 PPHTARAALRQAFQDWSNVAPLTFQEV-----QAGAADIRLS------FHGRQSSYCSNT 552

Query: 199 FDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSN 258
           FDG G  LAHA  P     G  HFD DE WT G   + G +L ++A HE+GHALGL HS 
Sbjct: 553 FDGPGRVLAHADIPEL---GSVHFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSR 717

Query: 259 DPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
              A+MAP Y+     +FKL  DD+ GIQ +YG
Sbjct: 718 YSQALMAPVYEGYR-PHFKLHPDDVAGIQALYG 813
 Score =  100 bits (249), Expect = 4e-19
 Identities = 57/180 (31%), Positives = 94/180 (51%), Gaps = 2/180 (1%)
 Frame = +2

Query: 356  RREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFV-FFKSNKFW 414
            R + + FK  + W V ++    G   +++  W GLP ++DA   +    ++ FFK +K W
Sbjct: 1052 RGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVW 1225

Query: 415  VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPG 474
             + +  + PG+P  L  +        +D+A++W    K + FKG  YW++ E  R+    
Sbjct: 1226 RYINFKMSPGFPKKLNRV-----EPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSS 1390

Query: 475  YPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYPRSILKDFMGC 533
            YPKPI  ++ G+P  P  A +  ++G  YF K K      + LRVE GYPR+I  ++M C
Sbjct: 1391 YPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHC 1567
>gb|U38431.1|HSU38431 Human clone rasi-6 matrix metalloproteinase RASI-1 mRNA, splice
           variant, complete cds
          Length = 2304

 Score =  133 bits (335), Expect = 4e-29
 Identities = 85/213 (39%), Positives = 118/213 (54%), Gaps = 5/213 (2%)
 Frame = +1

Query: 84  MTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKV 143
           ++G++D  T   M++PRCG+ D       FN +  +Y L G +W+ KH+ + I N+   +
Sbjct: 247 VSGQLDDATRARMRQPRCGLEDP------FNQKTLKYLLLG-RWRKKHLTFRILNLPSTL 405

Query: 144 GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD-----SSP 198
                R A+R+AF  W NV PLTF+EV     + G  D+ ++      FHG      S+ 
Sbjct: 406 PPHTARAALRQAFQDWSNVAPLTFQEV-----QAGAADIRLS------FHGRQSSYCSNT 552

Query: 199 FDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSN 258
           FDG G  LAHA  P     G  HFD DE WT G   + G +L ++A HE+GHALGL HS 
Sbjct: 553 FDGPGRVLAHADIPEL---GSVHFDEDEFWTEG--TYRGVNLRIIAAHEVGHALGLGHSR 717

Query: 259 DPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
              A+MAP Y+     +FKL  DD+ GIQ +YG
Sbjct: 718 YSQALMAPVYEGYR-PHFKLHPDDVAGIQALYG 813
 Score =  100 bits (249), Expect = 4e-19
 Identities = 57/180 (31%), Positives = 94/180 (51%), Gaps = 2/180 (1%)
 Frame = +2

Query: 356  RREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSEGNFV-FFKSNKFW 414
            R + + FK  + W V ++    G   +++  W GLP ++DA   +    ++ FFK +K W
Sbjct: 1052 RGKTYAFKGDYVWTVSDSG--PGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVW 1225

Query: 415  VFKDTTLQPGYPHDLITLGSGIPSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPG 474
             + +  + PG+P  L  +        +D+A++W    K + FKG  YW++ E  R+    
Sbjct: 1226 RYINFKMSPGFPKKLNRV-----EPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSS 1390

Query: 475  YPKPIT-IWKGIPESPQGAFVHKENGFTYFIKEKSTGNSTKMLRVEPGYPRSILKDFMGC 533
            YPKPI  ++ G+P  P  A +  ++G  YF K K      + LRVE GYPR+I  ++M C
Sbjct: 1391 YPKPIKGLFTGVPNQPSAA-MSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHC 1567
>dbj|AB007816.1|AB007816 Caenorhabditis elegans mRNA for matrix metalloproteinase, partial
           cds
          Length = 1834

 Score =  128 bits (322), Expect = 1e-27
 Identities = 84/266 (31%), Positives = 128/266 (47%), Gaps = 21/266 (7%)
 Frame = +1

Query: 47  LQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD- 105
           ++KYGYL   D       S +  + A+   Q+   +  TG VD  T++   KPRC   D 
Sbjct: 541 MEKYGYLKGIDHS-----SPQEFRQALMFFQEVLEVEQTGNVDEMTVEAASKPRCTQTDV 705

Query: 106 ---QTRGSSKFNIRRKRYALTGQKWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
              QT+ + +F+   K   +  +  Q   + + I + T  +   ETRK + +AF +W + 
Sbjct: 706 RQEQTKRTKRFS-SLKTSQVGARSGQSVTLKWYISDYTSDIDRLETRKVVEKAFKLWSSQ 882

Query: 163 TPLTFEEVPYIELE--NGKRDVDITIIFASGFHGDSSPFDGEGG---------FLAHAYF 211
           + +  E+   +  +  + K + DI I++A G HGD   FDG  G          LAH +F
Sbjct: 883 SYIKNEKKVTLTFQEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHTFF 1062

Query: 212 PGPG--IGGDTHFDSDEPWTLG--NPNHDGNDLFL--VAVHELGHALGLEHSNDPTAIMA 265
           PG    + GD HFD  E W +      H  N  F   V  HE+GHALGL+HS    A+M 
Sbjct: 1063PGYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADALMH 1242

Query: 266 PFYQYMETDNFKLPNDDLQGIQKIYG 291
           P+Y+ +  +  +L  DD  G+   YG
Sbjct: 1243PYYKNVPINEIQLDIDDKCGVIWNYG 1320
>ref|NM_130068.1| Arabidopsis thaliana chromosome 2  CHR2v12152001 genomic sequence
          Length = 1215

 Score =  128 bits (321), Expect = 2e-27
 Identities = 87/255 (34%), Positives = 124/255 (48%), Gaps = 10/255 (3%)
 Frame = +1

Query: 47  LQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQ 106
           LQ+YGYLP       V     + + A+   Q+  G+ +TGK D +T+  +  PRCG PD 
Sbjct: 193 LQQYGYLPQNKESDDV-----SFEQALVRYQKNLGLPITGKPDSDTLSQILLPRCGFPDD 357

Query: 107 TRG-SSKFNIRRKRYALTGQ-KWQHK-----HIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
               ++ F+  +K     G+ +W          A+S +N+TP +   + R+  RRAF  W
Sbjct: 358 VEPKTAPFHTGKKYVYFPGRPRWTRDVPLKLTYAFSQENLTPYLAPTDIRRVFRRAFGKW 537

Query: 160 QNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
            +V P++F E     +       DI I F +G HGD  PFDG  G LAH + P     G 
Sbjct: 538 ASVIPVSFIETEDYVI------ADIKIGFFNGDHGDGEPFDGVLGVLAHTFSPE---NGR 690

Query: 220 THFDSDEPWTLGNPNHDGN---DLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
            H D  E W +       +   DL  VAVHE+GH LGL HS+   A M P  +   +   
Sbjct: 691 LHLDKAETWAVDFDEEKSSVAVDLESVAVHEIGHVLGLGHSSVKDAAMYPTLK-PRSKKV 867

Query: 277 KLPNDDLQGIQKIYG 291
            L  DD+ G+Q +YG
Sbjct: 868 NLNMDDVVGVQSLYG 912
>gb|AC007659.2|AC007659 Arabidopsis thaliana chromosome II section 241 of 255 of the complete
             sequence. Sequence from clones T13E15, T14P1
          Length = 87885

 Score =  128 bits (321), Expect = 2e-27
 Identities = 87/255 (34%), Positives = 124/255 (48%), Gaps = 10/255 (3%)
 Frame = +1

Query: 47    LQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQ 106
             LQ+YGYLP       V     + + A+   Q+  G+ +TGK D +T+  +  PRCG PD 
Sbjct: 43489 LQQYGYLPQNKESDDV-----SFEQALVRYQKNLGLPITGKPDSDTLSQILLPRCGFPDD 43653

Query: 107   TRG-SSKFNIRRKRYALTGQ-KWQHK-----HIAYSIKNVTPKVGDAETRKAIRRAFDVW 159
                 ++ F+  +K     G+ +W          A+S +N+TP +   + R+  RRAF  W
Sbjct: 43654 VEPKTAPFHTGKKYVYFPGRPRWTRDVPLKLTYAFSQENLTPYLAPTDIRRVFRRAFGKW 43833

Query: 160   QNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGD 219
              +V P++F E     +       DI I F +G HGD  PFDG  G LAH + P     G 
Sbjct: 43834 ASVIPVSFIETEDYVI------ADIKIGFFNGDHGDGEPFDGVLGVLAHTFSPE---NGR 43986

Query: 220   THFDSDEPWTLGNPNHDGN---DLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNF 276
              H D  E W +       +   DL  VAVHE+GH LGL HS+   A M P  +   +   
Sbjct: 43987 LHLDKAETWAVDFDEEKSSVAVDLESVAVHEIGHVLGLGHSSVKDAAMYPTLK-PRSKKV 44163

Query: 277   KLPNDDLQGIQKIYG 291
              L  DD+ G+Q +YG
Sbjct: 44164 NLNMDDVVGVQSLYG 44208
>gb|BC006093.1|BC006093 Homo sapiens, matrix metalloproteinase 9 (gelatinase B, 92kD
           gelatinase, 92kD type IV collagenase), clone MGC:12688
           IMAGE:4054882, mRNA, complete cds
          Length = 2373

 Score =  127 bits (318), Expect = 4e-27
 Identities = 78/200 (39%), Positives = 102/200 (51%), Gaps = 5/200 (2%)
 Frame = +3

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L +YGY    + R      ++++  A+  +Q+   +  TG++D  T+  M+ PRCGV
Sbjct: 141 EEYLYRYGYTRVAEMR----GESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGV 308

Query: 104 PDQTRGSSKFNIRRKRYALTGQ-KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           PD  R  +            G  KW H +I Y I+N +  +  A    A  RAF +W  V
Sbjct: 309 PDLGRFQT----------FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAV 458

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPLTF  V         RD DI I F    HGD  PFDG+ G LAHA+ PGPGI GD HF
Sbjct: 459 TPLTFTRVY-------SRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHF 617

Query: 223 DSDEPWTLGN----PNHDGN 238
           D DE W+LG     P   GN
Sbjct: 618 DDDELWSLGKGVVVPTRFGN 677
 Score = 96.7 bits (239), Expect = 6e-18
 Identities = 82/312 (26%), Positives = 127/312 (40%), Gaps = 24/312 (7%)
 Frame = +3

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            ++FDSD+ W  G     G  LFLVA HE GHALGL+HS+ P A+M P Y++  T+   L 
Sbjct: 1134 SNFDSDKKW--GFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRF--TEGPPLH 1301

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD+ GI+ +YG                   + PP                       P 
Sbjct: 1302 KDDVNGIRHLYG--PRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS 1475

Query: 340  AKP--------------------NICDGN-FNTLVILRREMFVFKDQWFWRVRNNR-VMD 377
            A P                    + C+ N F+ +  +  ++++FKD  +WR    R    
Sbjct: 1476 AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRP 1655

Query: 378  GYPMQITYFWRGLPPSIDAVYENS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGI 436
              P  I   W  LP  +D+V+E        FF   + WV+   ++    P  L  LG G 
Sbjct: 1656 QGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLG--PRRLDKLGLGA 1829

Query: 437  PSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVH 495
                +  A+     GK   F G R WR+  + + +DP     +  ++ G+P      F +
Sbjct: 1830 DVAQVTGAL-RSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY 2006

Query: 496  KENGFTYFIKEK 507
            +E    YF +++
Sbjct: 2007 REK--AYFCQDR 2036
>ref|NM_004994.1| Homo sapiens matrix metalloproteinase 9 (gelatinase B, 92kD
           gelatinase, 92kD type IV collagenase) (MMP9), mRNA
          Length = 2334

 Score =  127 bits (318), Expect = 4e-27
 Identities = 78/200 (39%), Positives = 102/200 (51%), Gaps = 5/200 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L +YGY    + R      ++++  A+  +Q+   +  TG++D  T+  M+ PRCGV
Sbjct: 155 EEYLYRYGYTRVAEMR----GESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGV 322

Query: 104 PDQTRGSSKFNIRRKRYALTGQ-KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           PD  R  +            G  KW H +I Y I+N +  +  A    A  RAF +W  V
Sbjct: 323 PDLGRFQT----------FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAV 472

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPLTF  V         RD DI I F    HGD  PFDG+ G LAHA+ PGPGI GD HF
Sbjct: 473 TPLTFTRVY-------SRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHF 631

Query: 223 DSDEPWTLGN----PNHDGN 238
           D DE W+LG     P   GN
Sbjct: 632 DDDELWSLGKGVVVPTRFGN 691
 Score = 96.7 bits (239), Expect = 6e-18
 Identities = 82/312 (26%), Positives = 127/312 (40%), Gaps = 24/312 (7%)
 Frame = +2

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            ++FDSD+ W  G     G  LFLVA HE GHALGL+HS+ P A+M P Y++  T+   L 
Sbjct: 1148 SNFDSDKKW--GFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRF--TEGPPLH 1315

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD+ GI+ +YG                   + PP                       P 
Sbjct: 1316 KDDVNGIRHLYG--PRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS 1489

Query: 340  AKP--------------------NICDGN-FNTLVILRREMFVFKDQWFWRVRNNR-VMD 377
            A P                    + C+ N F+ +  +  ++++FKD  +WR    R    
Sbjct: 1490 AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRP 1669

Query: 378  GYPMQITYFWRGLPPSIDAVYENS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGI 436
              P  I   W  LP  +D+V+E        FF   + WV+   ++    P  L  LG G 
Sbjct: 1670 QGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLG--PRRLDKLGLGA 1843

Query: 437  PSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVH 495
                +  A+     GK   F G R WR+  + + +DP     +  ++ G+P      F +
Sbjct: 1844 DVAQVTGAL-RSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY 2020

Query: 496  KENGFTYFIKEK 507
            +E    YF +++
Sbjct: 2021 REK--AYFCQDR 2050
>gb|J05070.1|HUM4COLA Human type IV collagenase mRNA, complete cds
          Length = 2334

 Score =  127 bits (318), Expect = 4e-27
 Identities = 78/200 (39%), Positives = 102/200 (51%), Gaps = 5/200 (2%)
 Frame = +2

Query: 44  EVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGV 103
           E +L +YGY    + R      ++++  A+  +Q+   +  TG++D  T+  M+ PRCGV
Sbjct: 155 EEYLYRYGYTRVAEMR----GESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGV 322

Query: 104 PDQTRGSSKFNIRRKRYALTGQ-KWQHKHIAYSIKNVTPKVGDAETRKAIRRAFDVWQNV 162
           PD  R  +            G  KW H +I Y I+N +  +  A    A  RAF +W  V
Sbjct: 323 PDLGRFQT----------FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAV 472

Query: 163 TPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF 222
           TPLTF  V         RD DI I F    HGD  PFDG+ G LAHA+ PGPGI GD HF
Sbjct: 473 TPLTFTRVY-------SRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHF 631

Query: 223 DSDEPWTLGN----PNHDGN 238
           D DE W+LG     P   GN
Sbjct: 632 DDDELWSLGKGVVVPTRFGN 691
 Score = 96.7 bits (239), Expect = 6e-18
 Identities = 82/312 (26%), Positives = 127/312 (40%), Gaps = 24/312 (7%)
 Frame = +2

Query: 220  THFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLP 279
            ++FDSD+ W  G     G  LFLVA HE GHALGL+HS+ P A+M P Y++  T+   L 
Sbjct: 1148 SNFDSDKKW--GFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRF--TEGPPLH 1315

Query: 280  NDDLQGIQKIYGXXXXXXXXXXXXXXXXXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPG 339
             DD+ GI+ +YG                   + PP                       P 
Sbjct: 1316 KDDVNGIRHLYG--PRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS 1489

Query: 340  AKP--------------------NICDGN-FNTLVILRREMFVFKDQWFWRVRNNR-VMD 377
            A P                    + C+ N F+ +  +  ++++FKD  +WR    R    
Sbjct: 1490 AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRP 1669

Query: 378  GYPMQITYFWRGLPPSIDAVYENS-EGNFVFFKSNKFWVFKDTTLQPGYPHDLITLGSGI 436
              P  I   W  LP  +D+V+E        FF   + WV+   ++    P  L  LG G 
Sbjct: 1670 QGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLG--PRRLDKLGLGA 1843

Query: 437  PSHGIDSAIWWEDVGKTYFFKGDRYWRYGEEMRSMDPGYPKPI-TIWKGIPESPQGAFVH 495
                +  A+     GK   F G R WR+  + + +DP     +  ++ G+P      F +
Sbjct: 1844 DVAQVTGAL-RSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY 2020

Query: 496  KENGFTYFIKEK 507
            +E    YF +++
Sbjct: 2021 REK--AYFCQDR 2050
>dbj|AB044413.1|AB044413 Sus scrofa MMP-3 mRNA for matrix metalloproteinase-3, partial cds
          Length = 418

 Score =  127 bits (318), Expect = 4e-27
 Identities = 67/153 (43%), Positives = 86/153 (55%)
 Frame = +2

Query: 76  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYALTGQKWQHKHIAYS 135
           MQ+F G+ +TGK+D NT++ M KPRCGVPD    S+   +          KW+   + Y 
Sbjct: 8   MQKFLGLEVTGKLDSNTLEVMHKPRCGVPDVGYFSTFPGL---------PKWRKNDLTYR 160

Query: 136 IKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGD 195
           I N T  +  +     I +A  +W+ VTPLTF ++        + + DI I FA   HGD
Sbjct: 161 IVNYTLDLPRSVIDSTIEKALKIWEEVTPLTFSKI-------SEGEADIMITFAVREHGD 319

Query: 196 SSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPW 228
            SPFDG G  LAHAY PGPGI GD HFD DE W
Sbjct: 320 FSPFDGPGKVLAHAYAPGPGIYGDAHFDDDEQW 418
>gb|U82541.1|XLU82541 Xenopus laevis matrix metalloproteinase (XMMP) mRNA, complete cds
          Length = 3127

 Score =  127 bits (318), Expect = 4e-27
 Identities = 134/501 (26%), Positives = 197/501 (38%), Gaps = 78/501 (15%)
 Frame = +2

Query: 57  DPRMSVLRSAETMQ--SAIAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPD--------- 105
           +PR  V    ++ Q   A+   Q+   + +TG +D  TI+ M KPRCGVPD         
Sbjct: 341 NPRQEVAEPTKSPQFIDALKKFQKLNNLPVTGTLDDATINAMNKPRCGVPDNQMAKKETE 520

Query: 106 ----------QTRGSSKFN--------IRRKRYA------------------LTGQKWQH 129
                     +T+ S            IRRKR+                    TG+ +  
Sbjct: 521 KPTAAQSLENKTKDSENVTQQNPDPPKIRRKRFLDMLMYSNKYREEQEALQKSTGKVFTK 700

Query: 130 KHIAYSI--KNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITII 187
           K + + +  +  + ++   E R   R AF +W  V PL FEE     L      +DI + 
Sbjct: 701 KLLKWRMIGEGYSNQLSINEQRYVFRLAFRMWSEVMPLDFEEDNTSPLSQ----IDIKLG 868

Query: 188 FASGFH-GDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVH 246
           F  G H G S  FDG G   AHA+F G     D HFD DE +T  +  H G  L  VA H
Sbjct: 869 FGRGRHLGCSRAFDGSGQEFAHAWFLG-----DIHFDDDEHFTAPSSEH-GISLLKVAAH 1030

Query: 247 ELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGXXXXXXXXXXXXXXX 306
           E+GH LGL H +   +IM P Y   +   F+L   D + IQ +YG               
Sbjct: 1031EIGHVLGLSHIHRVGSIMQPNY-IPQDSGFELDLSDRRAIQNLYGS-------------- 1165

Query: 307 XXHRSIPPAXXXXXXXXXXXXXXXXXXXXSYPGAKPNICDGNFNTL-------------V 353
                                                 C+G F+T              +
Sbjct: 1166--------------------------------------CEGPFDTAFDWIYKEKNQYGEL 1231

Query: 354 ILRREMFVFKDQWFWRV--RNNRVMDGYPMQITYFWRGLP-PSIDA---VYENSEGNFVF 407
           ++R   + F++ W+W    R+NR   G P+ I   W G+P  +IDA   V+  +     F
Sbjct: 1232VVRYNTYFFRNSWYWMYENRSNRTRYGDPLAIANGWHGIPVQNIDAFVHVWTWTRDASYF 1411

Query: 408 FKSNKFWVFKDTTLQPGYPHD--------LITLG-SGIPSHGIDSAIWWEDVGKTYFFKG 458
           FK  ++W + D+     Y  D        LI+ G  GIPS  I++A +       YFF+ 
Sbjct: 1412FKGTQYWRY-DSENDKAYAEDAQGKSYPRLISEGFPGIPS-PINAAYFDRRRQYIYFFRD 1585

Query: 459 DRYWRYGEEMRSMDPGYPKPI 479
            + + +      + P +PK I
Sbjct: 1586SQVFAFDINRNRVAPDFPKRI 1648
 Score = 56.2 bits (134), Expect = 9e-06
 Identities = 39/141 (27%), Positives = 64/141 (44%), Gaps = 14/141 (9%)
 Frame = +2

Query: 404  NFVFFKSNKFWVFKDTTLQPGYPHDLITLGS--GIPSHGIDSAI----WWEDVGKTYFFK 457
            N  FF+++ +W++++ + +  Y   L       GIP   ID+ +    W  D   +YFFK
Sbjct: 1244 NTYFFRNSWYWMYENRSNRTRYGDPLAIANGWHGIPVQNIDAFVHVWTWTRDA--SYFFK 1417

Query: 458  GDRYWRYGEE------MRSMDPGYPKPITI-WKGIPESPQGAFVHKENGFTYFIKEKST- 509
            G +YWRY  E        +    YP+ I+  + GIP     A+  +   + YF ++    
Sbjct: 1418 GTQYWRYDSENDKAYAEDAQGKSYPRLISEGFPGIPSPINAAYFDRRRQYIYFFRDSQVF 1597

Query: 510  GNSTKMLRVEPGYPRSILKDF 530
                   RV P +P+ IL  F
Sbjct: 1598 AFDINRNRVAPDFPKRILDFF 1660
 Score = 38.5 bits (88), Expect = 2.0
 Identities = 30/138 (21%), Positives = 57/138 (40%), Gaps = 17/138 (12%)
 Frame = +2

Query: 356  RREMFVFKDQWFWRV--RNNRVM------DGYPMQITYFWRGLPPSIDAVYENSEGNFV- 406
            R   + FK   +WR    N++          YP  I+  + G+P  I+A Y +    ++ 
Sbjct: 1394 RDASYFFKGTQYWRYDSENDKAYAEDAQGKSYPRLISEGFPGIPSPINAAYFDRRRQYIY 1573

Query: 407  FFKSNKFWVF--KDTTLQPGYPHDLITLGSGI-----PSHGIDSAIWWEDVGKTYFFKGD 459
            FF+ ++ + F      + P +P  ++     +     P   ID A +       + FKG 
Sbjct: 1574 FFRDSQVFAFDINRNRVAPDFPKRILDFFPAVAANNHPKGNIDVAYYSYTYSSLFLFKGK 1753

Query: 460  RYWR-YGEEMRSMDPGYP 476
             +W+   ++ R  +P  P
Sbjct: 1754 EFWKVVSDKDRRQNPSLP 1807
>gb|AC005966.2|T2K10 Arabidopsis thaliana chromosome 1 BAC T2K10 sequence, complete
            sequence
          Length = 90284

 Score =  125 bits (315), Expect = 9e-27
 Identities = 97/276 (35%), Positives = 133/276 (48%), Gaps = 20/276 (7%)
 Frame = +1

Query: 36   KAEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSAIAAMQQFYGINMTGKVDRNTIDW 95
            K +QYF      +++GY+  T          + +QSAI   Q+ + + +TGK+D +T+  
Sbjct: 1588 KLKQYF------RRFGYITTTGNCTDDFD--DVLQSAINTYQKNFNLKVTGKLDSSTLRQ 1743

Query: 96   MKKPRCGVPDQTRGSSKFNIRR-----KRYALTGQK--W--QHKHIAYSI---KNVTPKV 143
            + KPRCG PD   G S+ N  +     ++Y+    K  W  + + + Y+     N+T   
Sbjct: 1744 IVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYAFAPQNNLTD-- 1917

Query: 144  GDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDVDITIIFASGFHGDSSPFDGEG 203
               E ++   RAF  W  VTPL F     I         DI I F SG HGD  PFDG  
Sbjct: 1918 ---EVKRVFSRAFTRWAEVTPLNFTRSESI------LRADIVIGFFSGEHGDGEPFDGAM 2070

Query: 204  GFLAHAYFPGPGIGGDTHFDSDEPWTLGN--------PNHDGNDLFLVAVHELGHALGLE 255
            G LAHA  P  G+    H D DE W + N        P     DL  VAVHE+GH LGL 
Sbjct: 2071 GTLAHASSPPTGM---LHLDGDEDWLISNGEISRRILPVTTVVDLESVAVHEIGHLLGLG 2241

Query: 256  HSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG 291
            HS+   AIM P     +    +L  DD++GIQ +YG
Sbjct: 2242 HSSVEDAIMFPAISGGDR-KVELAKDDIEGIQHLYG 2346
  Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS,
  or phase 0, 1 or 2 HTGS sequences)
    Posted date:  Feb 22, 2002 12:59 AM
  Number of letters in database: 602,804,554
  Number of sequences in database:  1,166,659
  
Lambda     K      H
   0.322    0.140     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 7.29e-304 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,791,863,459
Number of Sequences: 1166659
Number of extensions: 62489698
Number of successful extensions: 250572
Number of sequences better than 10.0: 974
Number of HSP's better than 10.0 without gapping: 48473
Number of HSP's successfully gapped in prelim test: 9707
Number of HSP's that attempted gapping in prelim test: 159979
Number of HSP's gapped (non-prelim): 140200
length of query: 608
length of database: 1,632,590,616
effective HSP length: 141
effective length of query: 467
effective length of database: 1,468,091,697
effective search space: 685598822499
effective search space used: 685598822499
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 82 (36.2 bits)