TBLASTN 2.2.2 [Dec-14-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 
         (880 letters)

Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS,
GSS, or phase 0, 1 or 2 HTGS sequences)
           1,164,257 sequences; 587,334,133 total letters

Searching... please wait.. done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|U18933.1|MMU18933  Mus musculus receptor tyrosine kinase ...  1637  0.0
gb|U18342.1|MMU18342  Mus musculus putative growth factor re...  1637  0.0
dbj|AB000828.1|AB000828  Mouse mRNA for receptor tyrosine ki...  1637  0.0
gb|U05683.1|MMU05683  Mus musculus receptor-type tyrosine ki...  1637  0.0
gb|U18343.1|MMU18343  Mus musculus putative growth factor re...  1634  0.0
ref|NM_019392.1|  Mus musculus TYRO3 protein tyrosine kinase...  1634  0.0
emb|X78103.1|MMTYRO3  M.musculus Tyro 3 mRNA for tyrosine ki...  1634  0.0
ref|NM_017092.1|  Rattus norvegicus Bruton agammaglobulinemi...  1592  0.0
dbj|D37880.1|RATSKY  Rat mRNA for Sky, complete cds              1592  0.0
ref|XM_007545.3|  Homo sapiens TYRO3 protein tyrosine kinase...  1464  0.0
dbj|D17517.1|HUMSKY  Human sky mRNA for Sky, complete cds        1464  0.0
gb|U05682.1|HSU05682  Human receptor-type tyrosine kinase (r...  1464  0.0
ref|NM_006293.1|  Homo sapiens TYRO3 protein tyrosine kinase...  1464  0.0
gb|U18934.1|HSU18934  Human receptor tyrosine kinase (DTK) m...  1464  0.0
dbj|D50479.1|D50479  Homo sapiens mRNA for protein-tyrosine ...  1456  0.0
dbj|D17393.1|MUSPTKAA  Mouse mRNA for protein tyrosine kinas...  1438  0.0
gb|U02566.1|HSU02566  Human receptor tyrosine kinase tif mRN...  1191  0.0
gb|U70045.1|GGU70045  Gallus gallus Axl-related receptor tyr...  1082  0.0
gb|AF021344.1|AF021344  Danio rerio developmental receptor t...   737  0.0
dbj|AB067527.1|AB067527  Rattus norvegicus axl gene for rat ...   642  0.0
dbj|AB067526.1|AB067526  Rattus norvegicus axl gene for rat ...   639  0.0
gb|M76125.1|HUMTYRKINR  Human tyrosine kinase receptor (axl)...   637  e-180
ref|NM_001699.2|  Homo sapiens AXL receptor tyrosine kinase ...   637  e-180
ref|XM_015505.1|  Homo sapiens AXL receptor tyrosine kinase ...   634  e-179
emb|X57019.1|HSUF025  H.sapiens mRNA for tyrosine kinase rec...   630  e-178
gb|S65125.1|S65125  UFO=proto-oncogene [human, NIH3T3 cell, ...   630  e-178
ref|NM_021913.1|  Homo sapiens AXL receptor tyrosine kinase ...   630  e-178
emb|X59560.1|MMTYRKR  M.musculus gene for tyrosine kinase re...   627  e-177
ref|NM_009465.1|  Mus musculus AXL receptor tyrosine kinase ...   627  e-177
emb|X63535.1|MMUFO  M.musculus ufo mRNA                           626  e-177
ref|NM_022943.1|  Rattus norvegicus MERTK (Mertk), mRNA           614  e-173
gb|AF208235.1|AF208235  Rattus norvegicus MERTK (Mertk) mRNA...   614  e-173
ref|NM_008587.1|  Mus musculus c-mer proto-oncogene (Mer), mRNA   612  e-173
gb|U21301.1|MMU21301  Mus musculus c-mer tyrosine kinase rec...   612  e-173
ref|NM_006343.1|  Homo sapiens c-mer proto-oncogene tyrosine...   610  e-172
gb|U08023.1|HSU08023  Human cellular proto-oncogene (c-mer) ...   610  e-172
gb|L21719.1|CHKCEYKONC  Chicken c-eyk proto-oncogene mRNA, c...   575  e-162
emb|X72886.1|HSTYRO3  H.sapiens TYRO3 mRNA                        551  e-154
gb|BC008551.1|  Mus musculus, clone IMAGE:3591640, mRNA           518  e-145
ref|XM_057391.1|  Homo sapiens c-mer proto-oncogene tyrosine...   443  e-122
ref|XR_000011.1|  Homo sapiens TYRO3P protein tyrosine kinas...   203  e-120
emb|X72887.1|HSTYRO3Y  H.sapiens TYRO3P mRNA                      203  e-120
gb|L11625.1|MUSRPTKA  Mus musculus receptor tyrosine kinase ...   432  e-119
gb|M92847.1|AREVRYK  Avian retrovirus tyrosine kinase (v-ryk...   406  e-111
gb|L08961.1|HUMSPRMTK  Homo sapiens transmembrane tyrosine k...   290  6e-76
gb|U77681.1|XLU77681  Xenopus laevis tyrosine kinase recepto...   254  4e-65
dbj|D87758.1|D87758  Xenopus laevis mRNA for Xron, complete cds   253  5e-65
gb|L12024.1|CHKCSEAX  Gallus gallus protooncogene c-sea rece...   250  4e-64
ref|XM_096924.1|  Homo sapiens similar to TYRO3 protein tyro...   249  9e-64
gb|M25158.1|AC2TKSEA  Avian retrovirus proviral tyrosine kin...   248  3e-63
emb|Y18562.1|GCY18562  Geodia cydonium mRNA for scavenger re...   248  3e-63
dbj|AB027411.1|AB027411  Xenopus laevis mRNA for c-met/hepat...   233  5e-59
ref|NM_031517.1|  Rattus norvegicus Met proto-oncogene (Met)...   232  1e-58
gb|U65007.1|RNU65007  Rattus norvegicus hepatocyte growth fa...   232  1e-58
ref|NM_008591.1|  Mus musculus met proto-oncogene (Met), mRNA     232  1e-58
emb|Y00671.1|MMMETONC  Mouse mRNA of met proto-oncogene           232  1e-58
emb|X54559.1|HSMETPRO  Homo sapiens mRNA for met proto-oncogene   231  2e-58
emb|X84044.1|GGRNACMET  G.gallus mRNA for c-met                   231  3e-58
ref|NM_009074.1|  Mus musculus macrophage stimulating 1 rece...   231  3e-58
emb|X74736.1|MMRONRTK  M.musculus mRNA for RON receptor tyro...   231  3e-58
gb|U08818.1|HSU08818  Human activated met oncogene mRNA, par...   231  3e-58
gb|U19348.1|HSU19348  Human (tpr-met fusion) oncogene mRNA, ...   231  3e-58
ref|NM_000245.1|  Homo sapiens met proto-oncogene (hepatocyt...   229  1e-57
gb|J02958.1|HUMMETPOA  Human MET proto-oncogene mRNA, comple...   229  1e-57
emb|X96786.1|RNCMET  r.norvegicus mRNA for HGF receptor           227  5e-57
ref|NM_002447.1|  Homo sapiens macrophage stimulating 1 rece...   226  8e-57
emb|X70040.1|HSRON  H.sapiens RON mRNA for tyrosine kinase        226  8e-57
ref|XM_011068.4|  Homo sapiens macrophage stimulating 1 rece...   226  1e-56
gb|AF111857.1|AF111857  Gallus gallus insulin receptor precu...   221  3e-55
ref|XM_048918.1|  Homo sapiens met proto-oncogene (hepatocyt...   165  4e-55
gb|AY043191.1|  Danio rerio insulin-like growth factor I rec...   219  7e-55
emb|AJ223164.1|GGAJ3164  Gallus gallus IGF receptor type 1 cDNA   218  2e-54
gb|AF216772.2|AF216772  Carassius auratus insulin-like growt...   218  2e-54
ref|NM_070710.1|  Eukaryotic protein kinase domain                218  2e-54
emb|AJ224994.1|PMA224994  Psetta maxima mRNA for insulin rec...   218  3e-54
emb|X54980.1|BTIGF1B  B.taurus mRNA for insulin-like growth ...   217  4e-54
gb|M13013.1|CHKROS  Chicken c-ros proto-oncogene, partial cds     217  4e-54
dbj|AB003362.2|AB003362  Sus scrofa mRNA for IGF-1 receptor,...   217  4e-54
gb|M10455.1|ACSUR2CG  Avian sarcoma virus UR2, complete genome    217  4e-54
gb|M35104.1|RATCROS1A  Rat lung-derived c-ros-1 proto-oncoge...   217  4e-54
ref|NM_012874.1|  Rattus norvegicus Rat heart - derived c - ...   217  4e-54
gb|M35106.1|RATCROS1C  Rat heart-derived c-ros-1 proto-oncog...   217  4e-54
emb|Z50155.1|XLIGF1R  X.laevis mRNA for insulin-like growth ...   216  1e-53
gb|M10051.1|HUMINSR  Human insulin receptor mRNA, complete cds    215  1e-53
ref|XM_048346.3|  Homo sapiens insulin receptor (INSR), mRNA      215  1e-53
ref|NM_052807.1|  Rattus norvegicus Insulin-like growth fact...   215  1e-53
gb|L29232.1|RATIGFIRT  Rattus norvegicus insulin-like growth...   215  1e-53
ref|NM_000208.1|  Homo sapiens insulin receptor (INSR), mRNA      215  1e-53
emb|AJ224993.1|PMA224993  Psetta maxima mRNA for insulin-lik...   215  2e-53
gb|AF056187.1|AF056187  Mus musculus insulin-like growth fac...   215  2e-53
ref|NM_000875.2|  Homo sapiens insulin-like growth factor 1 ...   215  2e-53
emb|X04434.1|HSIGFIRR  Human mRNA for insulin-like growth fa...   215  2e-53
dbj|AB065096.1|AB065096  Paralichthys olivaceus fIR-1 mRNA f...   214  4e-53
gb|AF055980.1|AF055980  Xenopus laevis insulin-like growth f...   214  4e-53
emb|X02160.1|HSIRPR  Human mRNA for insulin receptor precursor    213  5e-53
ref|NM_010568.1|  Mus musculus insulin receptor (Insr), mRNA      213  5e-53
gb|J05149.1|MUSINSR  Mouse insulin receptor (IR) mRNA, compl...   213  5e-53
dbj|AB050625.1|AB050625  Cynops pyrrhogaster IGF-IR mRNA for...   213  5e-53
emb|Z27409.1|HSRTKEPH  H.sapiens mRNA for receptor tyrosine ...   213  9e-53
dbj|AB065097.1|AB065097  Paralichthys olivaceus fIR-2 mRNA f...   213  9e-53
emb|AJ132556.1|XLA132556  Xenopus laevis mRNA for insulin re...   212  1e-52
ref|NM_017071.1|  Rattus norvegicus Insulin receptor (Insr),...   212  1e-52
gb|M29014.1|RATINSAB  Rat insulin receptor mRNA, complete cds     212  1e-52
dbj|AB065099.1|AB065099  Paralichthys olivaceus fIGF-IR-2 mR...   212  2e-52
gb|U15443.1|MMU15443  Mus musculus proto-oncogene protein c-...   211  2e-52
emb|X15786.1|HSRETTT  Human ret-II gene                           211  2e-52
emb|AJ222795.1|XLMUSK  Xenopus laevis mRNA for muscle specif...   211  2e-52
emb|X81650.1|MMCROSP  M.musculus mRNA for c-ros protooncogene     211  2e-52
ref|XM_056982.1|  Homo sapiens EphA1 (EPHA1), mRNA                211  3e-52
gb|AY058497.1|  Drosophila melanogaster LD03455 full length ...   211  3e-52
ref|NM_080104.1|  Drosophila melanogaster Abl oncogene (Abl)...   211  3e-52
gb|AF209436.1|AF209436  Mus musculus c-ret proto-oncogene mR...   210  4e-52
emb|Z49898.1|GDRETMRNA  G.domesticus mRNA for ret protein         210  4e-52
dbj|AB006563.3|AB006563  Ephydatia fluviatilis EfPTK28 mRNA ...   210  6e-52
dbj|AB065098.1|AB065098  Paralichthys olivaceus fIGF-IR-1 mR...   209  1e-51
ref|NM_005157.2|  Homo sapiens v-abl Abelson murine leukemia...   209  1e-51
gb|M31213.1|HUMPTCAA  Human papillary thyroid carcinoma-enco...   209  1e-51
gb|M14752.1|HUMABLA  Human c-abl gene, complete cds               209  1e-51
gb|AF062497.1|AF062497  Oncorhynchus mykiss insulin receptor...   209  1e-51
ref|NM_007313.1|  Homo sapiens v-abl Abelson murine leukemia...   209  1e-51
ref|NM_078559.1|  Drosophila melanogaster sevenless (sev), mRNA   208  2e-51
emb|X13666.1|DMSEVL2  Drosophila melanogaster mRNA for seven...   208  2e-51
ref|NM_005232.1|  Homo sapiens EphA1 (EPHA1), mRNA                208  2e-51
gb|M18391.1|HUMTKR  Human tyrosine kinase receptor (eph) mRN...   208  2e-51
emb|X56348.1|HSURFRET  H.sapiens urf-ret mRNA                     208  2e-51
ref|NM_020629.1|  Homo sapiens ret proto-oncogene (multiple ...   208  2e-51
gb|AF286643.1|AF286643  Xenopus laevis c-ret (Ret) mRNA, com...   208  2e-51
ref|XM_049008.2|  Homo sapiens ret proto-oncogene (multiple ...   208  2e-51
emb|X12949.1|HSRETPON  Human ret proto-oncogene mRNA for tyr...   208  2e-51
ref|NM_020630.1|  Homo sapiens ret proto-oncogene (multiple ...   208  2e-51
ref|NM_020975.1|  Homo sapiens ret proto-oncogene (multiple ...   208  2e-51
ref|NM_000323.1|  Homo sapiens ret proto-oncogene (multiple ...   208  2e-51
gb|BC004257.1|BC004257  Homo sapiens, ret proto-oncogene (mu...   207  3e-51
gb|L03357.1|HUMRETRI  Homo sapiens fusion protein RET tyrosi...   207  3e-51
gb|M16029.1|HUMTYKRET  Human ret mRNA encoding a tyrosine ki...   207  3e-51
gb|J05047.1|GPIIRRA  Guinea pig insulin receptor-related rec...   207  3e-51
dbj|AB006561.3|AB006561  Ephydatia fluviatilis EfPTK16 mRNA ...   207  3e-51
ref|NM_002944.1|  Homo sapiens v-ros UR2 sarcoma virus oncog...   207  3e-51
gb|M34353.1|HUMROSA  Human transmembrane tyrosine-specific p...   207  3e-51
ref|NM_009050.1|  Mus musculus ret proto-oncogene (Ret), mRNA     207  4e-51
emb|X67812.1|MMRET  M.musculus mRNA for ret proto-oncogene        207  4e-51
gb|M13880.1|HUMROSMCF  Human mcf3 (rearranged ros1) proto-on...   207  4e-51
emb|AJ299016.1|RNO299016  Rattus norvegicus mRNA for recepto...   207  4e-51
emb|AJ299017.1|RNO299017  Rattus norvegicus mRNA for recepto...   207  4e-51
ref|XM_043563.2|  Homo sapiens insulin receptor-related rece...   206  6e-51
gb|J05046.1|HUMIRRA  Human insulin receptor-related receptor...   206  6e-51
gb|AF007949.1|AF007949  Danio rerio receptor tyrosine kinase...   206  8e-51
ref|XM_033355.1|  Homo sapiens v-abl Abelson murine leukemia...   206  8e-51
emb|X16416.1|HSABL  Human c-abl mRNA encoding p150 protein        206  8e-51
emb|X94363.1|DRRET1  D.rerio ret1 gene for receptor tyrosine...   206  8e-51
ref|XM_011817.3|  Homo sapiens muscle, skeletal, receptor ty...   206  1e-50
ref|NM_005592.1|  Homo sapiens muscle, skeletal, receptor ty...   206  1e-50
gb|AF006464.1|AF006464  Homo sapiens muscle specific tyrosin...   206  1e-50
gb|L10656.1|MUSCABL  Mouse tyrosine kinase (c-abl) mRNA           205  1e-50
gb|M35105.1|RATCROS1B  Rat lung-derived L01 c-ros-1 proto-on...   205  1e-50
emb|X02963.1|REABMLVA  Abelson (P160) murine leukemia virus ...   205  1e-50
gb|AF033812.1|AF033812  Abelson murine leukemia virus, compl...   205  1e-50
emb|V01541.1|REAMLV  Abelson murine leukemia virus genome wi...   205  1e-50
gb|J02009.1|MLAPRO  Abelson murine leukemia virus (proviral)...   205  1e-50
gb|J02995.1|MUSABLTS  Mouse testis-specific c-abl protein mR...   205  1e-50
gb|L11311.1|FSCTRKA  Torpedo californica receptor tyrosine k...   204  3e-50
gb|AF236106.1|AF236106  Drosophila melanogaster receptor pro...   204  4e-50
ref|NM_011832.1|  Mus musculus insulin receptor-related rece...   204  4e-50
dbj|AB007135.1|AB007135  Mus musculus IRR mRNA for insulin r...   204  4e-50
gb|AF025542.1|AF025542  Bombyx mori insulin receptor-like pr...   204  4e-50
ref|XM_080568.1|  Alk, mRNA                                       204  4e-50
gb|AE003806.2|AE003806  Drosophila melanogaster genomic scaf...   203  5e-50
gb|AC091501.1|AC091501  Drosophila melanogaster, chromosome ...   203  5e-50
gb|AC004287.1|AC004287  Drosophila melanogaster DNA sequence...   203  5e-50
gb|AF322653.1|AF322653  Drosophila melanogaster tyrosine kin...   202  9e-50
emb|X71424.1|BTTIE2A  B.taurus Tie 2 mRNA                         202  9e-50
ref|NM_057696.1|  Drosophila melanogaster Ret oncogene (Ret)...   202  9e-50
gb|AF322652.1|AF322652  Drosophila melanogaster tyrosine kin...   202  9e-50
emb|AJ237973.1|DME237973  Drosophila melanogaster mRNA for R...   202  9e-50
ref|NM_031061.1|  Rattus norvegicus Muscle specific kinase (...   202  1e-49
gb|U34985.1|RNU34985  Rattus norvegicus muscle-specific tyro...   202  1e-49
gb|M15805.1|FCSHZ2A  Hardy-Zuckerman 2 feline sarcoma virus ...   202  1e-49
gb|AF062498.1|AF062498  Oncorhynchus mykiss insulin receptor...   202  2e-49
ref|NM_010944.1|  Mus musculus muscle, skeletal, receptor ty...   201  2e-49
gb|U37708.1|MMU37708  Mus musculus muscle localized kinase 1...   201  2e-49
emb|X86445.1|MMNSK22  M.musculus Nsk2 gene 3132bp                 201  2e-49
gb|U37709.1|MMU37709  Mus musculus muscle localized kinase 2...   201  2e-49
emb|X86444.1|MMNSK21  M.musculus Nsk2 gene 3257bp                 201  2e-49
gb|AF348085.1|AF348085  Danio rerio focal adhesion kinase mR...   201  4e-49
emb|X84994.1|LSMIPRMR  L.stagnalis mRNA for putative mollusc...   201  4e-49
dbj|AB054534.1|AB054534  Gallus gallus mRNA for tyrosine kin...   200  6e-49
ref|NM_007982.1|  Mus musculus PTK2 protein tyrosine kinase ...   200  6e-49
gb|M95408.1|MUSFAK  Mouse focal adhesion kinase mRNA, comple...   200  6e-49
gb|S53216.1|S53216  vik=variant in the kinase [mice, mRNA, 2...   200  6e-49
gb|AF020777.1|AF020777  Rattus norvegicus focal adhesion kin...   200  6e-49
ref|NM_013081.1|  Rattus norvegicus Protein tyrosine kinase ...   200  6e-49
gb|L13616.1|HUMFAKX  Human focal adhesion kinase (FAK) mRNA,...   200  6e-49
gb|M86656.1|CHKFAK  Chicken focal adhesion molecule (FAK) mR...   200  6e-49
emb|X06770.1|GGROSCR  Chicken c-ros mRNA                          200  6e-49
ref|NM_023580.1|  Mus musculus RIKEN cDNA 5730453L17 gene (5...   199  8e-49
gb|AF131197.1|AF131197  Mus musculus receptor tyrosine kinas...   199  8e-49
ref|NM_007439.1|  Mus musculus anaplastic lymphoma kinase (A...   199  8e-49
dbj|D83002.1|D83002  Mouse mRNA for tyrosine kinase, complet...   199  8e-49
ref|XM_055726.2|  Homo sapiens anaplastic lymphoma kinase (K...   199  1e-48
ref|NM_005158.2|  Homo sapiens v-abl Abelson murine leukemia...   199  1e-48
gb|AF125093.1|AF125093  Homo sapiens TRK-fused gene-anaplast...   199  1e-48
gb|U04946.1|HSU04946  Human nucleophosmin-anaplastic lymphom...   199  1e-48
ref|NM_004304.2|  Homo sapiens anaplastic lymphoma kinase (K...   199  1e-48
gb|U66559.1|HSU66559  Human anaplastic lymphoma kinase recep...   199  1e-48
ref|NM_007314.1|  Homo sapiens v-abl Abelson murine leukemia...   199  1e-48
gb|M35296.1|HUMARGCAA  Human tyrosine kinase arg gene mRNA        199  1e-48
dbj|D45915.1|D45915  Human mRNA for p80 protein, complete cds     199  1e-48
gb|U62540.1|HSU62540  Human anaplastic lymphoma kinase (ALK)...   199  1e-48
gb|U23783.1|GGU23783  Gallus gallus embryo kinase 9 protein ...   199  1e-48
gb|AF143407.1|AF143407  Homo sapiens TRK-fused gene/anaplast...   199  1e-48
ref|NM_005424.1|  Homo sapiens tyrosine kinase with immunogl...   199  1e-48
emb|X60957.1|HSTIEMR  Human tie mRNA for putative receptor t...   199  1e-48
gb|U11078.1|XLU11078  Xenopus laevis focal adhesion kinase p...   198  2e-48
gb|S83394.1|S83394  insulin-like peptide receptor [Branchios...   198  2e-48
ref|NM_013690.1|  Mus musculus endothelial-specific receptor...   197  3e-48
dbj|D13738.1|MUSHYK  Mouse mRNA for receptor tyrosine kinase...   197  3e-48
gb|BC006963.1|BC006963  Mus musculus, clone IMAGE:3708410, m...   197  4e-48
gb|L02210.1|MUSYKINA  Mus musculus tyrosine kinase-related p...   197  4e-48
gb|L38394.1|MUSRYK  Mus Musculus receptor tyrosine kinase-re...   197  4e-48
ref|NM_011587.1|  Mus musculus tyrosine kinase receptor 1 (T...   197  4e-48
emb|X80764.1|MMTIE1  M.musculus TIE1 mRNA                         197  4e-48
emb|X71425.1|MMTIE1A  M.musculus Tie 1 mRNA                       197  4e-48
emb|X73960.1|MMTIERTK  M.musculus mRNA for TIE receptor tyro...   197  4e-48
ref|NM_002958.1|  Homo sapiens RYK receptor-like tyrosine ki...   197  5e-48
gb|M98547.1|MUSRTKRP  Mouse growth factor receptor (RYK) mRN...   197  5e-48
gb|BC021700.1|BC021700  Homo sapiens, clone IMAGE:4052080, m...   197  5e-48
emb|X96588.1|HSHRYKG  H.sapiens mRNA for H-RYK receptor tyro...   197  5e-48
emb|X71426.1|MMTIE2A  M.musculus Tie 2 mRNA                       196  7e-48
emb|X71423.1|BTTIE1A  B.taurus Tie 1 mRNA                         196  9e-48
gb|AF062496.1|AF062496  Oncorhynchus mykiss insulin receptor...   196  9e-48
gb|L33920.1|XELFAK  Xenopus laevis (clones 16, 5p, and 3p) f...   196  1e-47
dbj|AB006559.3|AB006559  Ephydatia fluviatilis EfPTK13 mRNA ...   196  1e-47
gb|U23839.1|DRU23839  Danio rerio fibroblast growth factor r...   196  1e-47
ref|NM_008000.1|  Mus musculus fer (fms/fps related) protein...   195  1e-47
gb|M32054.1|MUSFERT  Mouse tyrosine kinase (ferT) mRNA, comp...   195  1e-47
gb|S67051.1|S67051  tie2=cell surface receptor homolog [mice...   195  1e-47
dbj|AB007036.1|AB007036  Xenopus laevis mRNA for FGF recepto...   195  1e-47
dbj|D31761.1|XELFGFR4  Xenopus laevis mRNA for fibroblast gr...   195  1e-47
emb|X67553.1|MMTEK  M. musculus mRNA for tek                      195  1e-47
gb|M91599.1|RATFGR4A  Rat fibroblast growth factor receptor ...   195  2e-47
gb|M64612.1|HYDTYRKINB  Hydra vulgaris protein-tyrosine kina...   195  2e-47
gb|M37722.1|HUMBFGFS  Human shorter form basic fibroblast gr...   195  2e-47
ref|NM_000459.1|  Homo sapiens TEK tyrosine kinase, endothel...   195  2e-47
gb|L06139.1|HUMTEKRPTK  Homo sapiens receptor protein-tyrosi...   195  2e-47
ref|XM_005480.4|  Homo sapiens TEK tyrosine kinase, endothel...   195  2e-47
ref|NM_010206.1|  Mus musculus fibroblast growth factor rece...   194  3e-47
gb|U22324.1|MMU22324  Mus musculus fibroblast growth factor ...   194  3e-47
gb|M28998.1|MUSBFGFR  Mouse basic fibroblast growth factor r...   194  3e-47
gb|U76762.1|MMU76762  Mus musculus fps/fes-related tyrosine ...   194  3e-47
gb|U23445.1|MMU23445  Mus musculus fibroblast growth factor ...   194  3e-47
gb|AE003526.2|AE003526  Drosophila melanogaster genomic scaf...   167  3e-47
gb|M24637.1|CHKCEK1  Chicken tyrosine kinase (cek1) mRNA, co...   194  3e-47
gb|M33760.1|MUSFGFR  Mouse FGF receptor mRNA, complete cds        194  3e-47
emb|X13412.1|RNFLK  Rat mRNA for flk protein                      194  3e-47
gb|AF211257.1|AF211257  Canis familiaris fibroblast growth f...   194  3e-47
gb|AC010688.5|  Drosophila melanogaster 3L BAC RP98-11G5 (Ro...   167  3e-47
gb|M19692.1|DROTKABL3  D.melanogaster tyrosine kinase gene, ...   167  3e-47
gb|K01042.1|DRODASH  D.melanogaster dash gene                     167  3e-47
gb|M65053.1|MUSFGFBC  Mouse fibroblast growth factor mRNA, c...   194  4e-47
emb|X51893.1|MMFGF  Mouse fms-like gene (mflg) mRNA for fibr...   193  6e-47
gb|M87770.1|HUMKSAMI  Human fibroblast growth factor recepto...   193  6e-47
gb|U24491.1|XLU24491  Xenopus laevis fibroblast growth facto...   193  6e-47
emb|X52832.1|HSFGFRBE  Human bek mRNA for fibroblast growth ...   193  6e-47
emb|Z69640.1|HSFGFR2UB  H.sapiens fgfr2 gene (exon 5)             193  6e-47
emb|Z69641.1|HSFGFR2UA  H.sapiens fgfr2 gene                      193  6e-47
emb|Z71929.1|HSFGFR2MR  H.sapiens FGFR2 mRNA                      193  6e-47
ref|NM_023029.1|  Homo sapiens fibroblast growth factor rece...   193  6e-47
gb|M97193.1|HUMFGFR2A  Homo sapiens fibroblast growth factor...   193  6e-47
ref|NM_022969.1|  Homo sapiens fibroblast growth factor rece...   193  6e-47
ref|NM_000141.2|  Homo sapiens fibroblast growth factor rece...   193  6e-47
gb|AF101195.1|AF101195  Biomphalaria glabrata insulin-relate...   193  6e-47
emb|X69970.1|HSHRYK  H.sapiens mRNA for h-ryk                     193  7e-47
emb|X55441.1|MMBEKFGF  Mouse bek genomic RNA for FGF-receptor     193  7e-47
gb|M63503.1|MUSKGFR  Mouse keratinocyte growth factor recept...   193  7e-47
ref|NM_010207.1|  Mus musculus fibroblast growth factor rece...   193  7e-47
gb|M86441.1|MUSBEKFGFA  M.musculus BEK FGF receptor mRNA, co...   193  7e-47
gb|U40827.1|MMU40827  Mus musculus tyrosine kinase (arg) mRN...   192  1e-46
emb|X52213.1|HSLTKM  H.sapiens ltk mRNA                           192  1e-46
gb|L19109.1|RATHBFGFRF  Rattus norvegicus (clone R2(CT1)) he...   192  1e-46
ref|NM_002344.1|  Homo sapiens leukocyte tyrosine kinase (LT...   192  1e-46
emb|X60702.1|HSLTK  Human ltk mRNA for tyrosine kinase            192  1e-46
dbj|D16105.1|HUMLTKLP2  Human mRNA for leukocyte tyrosine ki...   192  1e-46
gb|M55163.1|XELX1FGFR  Xenopus laevis fibroblast growth fact...   192  1e-46
gb|S54008.1|S54008  fibroblast growth factor receptor 1 beta...   192  1e-46
emb|X57120.1|HSFGR3IG  Human mRNA for fibroblast growth rece...   192  1e-46
emb|X51803.1|HSFGFR  Human mRNA for fibroblast growth factor...   192  1e-46
emb|X66945.1|HSNSAMTK  H.sapiens N-sam mRNA for fibroblast g...   192  1e-46
ref|NM_023106.1|  Homo sapiens fibroblast growth factor rece...   192  1e-46
emb|X57121.1|HSFGR3IGA  Human mRNA for fibroblast growth rec...   192  1e-46
gb|AF389400.1|AF389400  Danio rerio fibroblast growth factor...   192  1e-46
ref|NM_022972.1|  Homo sapiens fibroblast growth factor rece...   192  1e-46
gb|M63887.1|HUMHBGFA  Human heparin-binding growth factor re...   192  1e-46
ref|NM_023105.1|  Homo sapiens fibroblast growth factor rece...   192  1e-46
gb|M34185.1|HUMFGF2H  Human fibroblast growth factor recepto...   192  1e-46
gb|M34641.1|HUMFGF1A  Human fibroblast growth factor (FGF) r...   192  1e-46
gb|M55614.1|HUMTK14  Human fibroblast growth factor receptor...   192  1e-46
ref|XM_049463.1|  Homo sapiens fibroblast growth factor rece...   192  1e-46
gb|AY037939.1|  Xenopus laevis angiopoietin receptor Xtie-2 ...   192  1e-46
ref|NM_000604.2|  Homo sapiens fibroblast growth factor rece...   192  1e-46
gb|M34186.1|HUMFGF3H  Human fibroblast growth factor recepto...   192  1e-46
ref|XM_007546.6|  Homo sapiens leukocyte tyrosine kinase (LT...   192  1e-46
emb|X57122.1|HSFGR2IG  Human mRNA for fibroblast growth rece...   192  1e-46
ref|NM_015850.2|  Homo sapiens fibroblast growth factor rece...   192  1e-46
ref|NM_022970.1|  Homo sapiens fibroblast growth factor rece...   192  1e-46
gb|AY070958.1|  Drosophila melanogaster RE05926 full length ...   192  1e-46
emb|Y00665.1|HSFLGMR  Human flg (fms-like gene) mRNA for put...   192  1e-46
emb|X57119.1|HSFGR2IGA  Human mRNA for fibroblast growth rec...   192  1e-46
emb|X52833.1|HSFGFRFL  Human flg mRNA for fibroblast growth ...   192  1e-46
gb|M60485.1|HUMFGFAA  Human fibroblast growth factor recepto...   192  1e-46
gb|M87771.1|HUMKSAMIII  Human secreted fibroblast growth fac...   192  1e-46
gb|L20297.1|DRORORTRK  Drosophila melanogaster neurotrophic ...   192  2e-46
ref|NM_057614.1|  Drosophila melanogaster  (Ror), transcript...   192  2e-46
ref|NM_023028.1|  Homo sapiens fibroblast growth factor rece...   192  2e-46
gb|AF288453.1|AF288453  Xenopus laevis fibroblast growth fac...   192  2e-46
dbj|AB007037.1|AB007037  Xenopus laevis mRNA for FGF recepto...   192  2e-46
emb|X57205.1|HSFGFR4  Human FGFR-4 mRNA for fibroblast growt...   191  2e-46
gb|AF202063.1|AF202063  Homo sapiens fibroblast growth facto...   191  2e-46
gb|BC011847.1|BC011847  Homo sapiens, fibroblast growth fact...   191  2e-46
gb|M23362.1|MUSBEK  Mus musculus tyrosine kinase (bek) mRNA,...   191  2e-46
emb|X76885.1|CCFREK  C.cortunix FREK mRNA for fibroblast gro...   191  2e-46
ref|NM_022963.1|  Homo sapiens fibroblast growth factor rece...   191  2e-46
ref|NM_002011.2|  Homo sapiens fibroblast growth factor rece...   191  2e-46
gb|AF359246.1|AF359246  Homo sapiens fibroblast growth facto...   191  2e-46
gb|L03840.1|HUMFGFR4X  Human fibroblast growth factor recept...   191  2e-46
gb|AF187884.1|AF187884  Canis familiaris protein tyrosine ki...   191  3e-46
ref|NM_077378.1|  Caenorhabditis elegans                          191  3e-46
ref|NM_077376.1|  Caenorhabditis elegans                          191  3e-46
ref|NM_077377.1|  Src homology domain 2, Src homology domain...   191  3e-46
gb|AF184968.1|AF184968  Oryctolagus cuniculus fibroblast gro...   191  4e-46
gb|AF176552.1|AF176552  Mus musculus fibroblast growth facto...   191  4e-46
emb|Z68150.1|BTFGFRECR  B.taurus mRNA for FGF-receptor            191  4e-46
gb|M62322.1|XELXFGFRA2  Xenopus laevis fibroblast growth fac...   190  5e-46
ref|NM_023030.1|  Homo sapiens fibroblast growth factor rece...   190  5e-46
dbj|AB007035.1|AB007035  Xenopus laevis mRNA for FGF recepto...   190  5e-46
ref|NM_024146.1|  Rattus norvegicus FGF receptor-1 (Fgfr1), ...   190  5e-46
dbj|D12498.1|RATFGFR1  Rat mRNA for FGF receptor-1, complete...   190  5e-46
gb|M80634.1|HUMKGFRA  Human keratinocyte growth factor recep...   190  5e-46
ref|NM_079712.1|  Drosophila melanogaster Insulin-like recep...   190  6e-46
gb|U28136.1|  Drosophila melanogaster insulin receptor homol...   190  6e-46
emb|X74332.1|PWFGFR2  P.waltl mRNA for fibroblast growth fac...   190  6e-46
gb|AF037164.1|AF037164  Drosophila melanogaster receptor tyr...   190  6e-46
gb|U18351.1|DMU18351  Drosophila melanogaster insulin recept...   190  6e-46
ref|NM_022974.1|  Homo sapiens fibroblast growth factor rece...   190  6e-46
gb|AC005471.1|AC005471  Drosophila melanogaster, chromosome ...   190  6e-46
gb|M35196.1|CHKCEK3  Chicken tyrosine kinase (cek3) mRNA, co...   190  6e-46
gb|AE003735.1|AE003735  Drosophila melanogaster genomic scaf...   190  6e-46
emb|X56191.1|HSBFR  Human bfr mRNA for fibroblast growth fac...   190  6e-46
ref|NM_022973.1|  Homo sapiens fibroblast growth factor rece...   190  6e-46
ref|NG_000601.1|  Drosophila melanogaster Neurospecific rece...   190  6e-46
ref|NM_057907.1|  Drosophila melanogaster Neurospecific rece...   190  6e-46
gb|AC006247.12|AC006247  Drosophila melanogaster, chromosome...   190  6e-46
dbj|AB001420.1|AB001420  Drosophila melanogaster mRNA for ne...   190  6e-46
gb|AE003819.2|AE003819  Drosophila melanogaster genomic scaf...   190  6e-46
ref|XM_082426.1|  Insulin-like receptor, mRNA                     190  6e-46
ref|NG_000596.1|  Drosophila melanogaster tripeptidyl-peptid...   190  6e-46
gb|AC006936.17|AC006936  Drosophila melanogaster, chromosome...   190  6e-46
dbj|AK026508.1|AK026508  Homo sapiens cDNA: FLJ22855 fis, cl...   190  6e-46
gb|U72939.1|AAU72939  Aedes aegypti insulin receptor mRNA, c...   189  8e-46
emb|X59380.1|PWFGFR  P.waltlii mRNA for fibroblast growth fa...   189  8e-46
gb|AY051812.1|  Drosophila melanogaster LD32130 full length ...   189  1e-45
ref|XM_082187.1|  heartless, mRNA                                 189  1e-45
gb|AC008361.8|AC008361  Drosophila melanogaster, chromosome ...   189  1e-45
gb|U39671.1|XLU39671  Xenopus laevis neurotrophin receptor B...   189  1e-45
ref|NM_023031.1|  Homo sapiens fibroblast growth factor rece...   189  1e-45
gb|L19868.1|NVI1FGFR  Notophtalmus viridescens fibroblast gr...   189  1e-45
gb|AC008362.5|AC008362  Drosophila melanogaster, chromosome ...   189  1e-45
gb|U39670.1|XLU39670  Xenopus laevis neurotrophin receptor B...   189  1e-45
dbj|AB006567.3|AB006567  Ephydatia fluviatilis EfPTK79 mRNA ...   189  1e-45
gb|AE003720.2|AE003720  Drosophila melanogaster genomic scaf...   189  1e-45
gb|M35718.1|HUMKSAMAA  Human heparin-binding growth factor r...   189  1e-45
ref|NM_022975.1|  Homo sapiens fibroblast growth factor rece...   189  1e-45
gb|U17164.1|SPU17164  Strongylocentrotus purpuratus fibrobla...   189  1e-45
gb|S56291.1|S56291  sam3=FGFR3 homolog [mice, brain, mRNA, 2...   188  2e-45
ref|NM_053429.1|  Rattus norvegicus fibroblast growth factor...   188  2e-45
gb|AF277717.1|AF277717  Rattus norvegicus fibroblast growth ...   188  2e-45
gb|AF217976.1|AF217976  Homo sapiens clone PP1440 unknown mRNA    188  2e-45
ref|NM_005246.1|  Homo sapiens fer (fps/fes related) tyrosin...   188  2e-45
gb|J03358.1|HUMTKFER  Human tyrosine kinase (FER) mRNA, comp...   188  2e-45
ref|NM_008010.1|  Mus musculus fibroblast growth factor rece...   188  2e-45
emb|X58255.1|HSFGL2  Mus musculus mRNA for fibroblast growth...   188  2e-45
gb|AF024638.1|AF024638  Mus musculus fibroblast growth facto...   188  2e-45
gb|M58051.1|HUMFGFR3  Human fibroblast growth factor recepto...   188  2e-45
ref|XM_044120.2|  Homo sapiens fibroblast growth factor rece...   188  2e-45
gb|AF245114.1|AF245114  Homo sapiens fibroblast growth facto...   188  2e-45
ref|NM_079670.1|  Drosophila melanogaster heartless (htl), mRNA   188  2e-45
dbj|D14976.1|DROFGFR1  D.melanogaster mRNA for fibroblast gr...   188  2e-45
dbj|D14977.1|DROFGFR2  D.melanogaster mRNA for fibroblast gr...   188  2e-45
gb|U43396.1|GGU43396  Gallus gallus tropomyosin receptor kin...   188  2e-45
emb|X75603.1|PWFGFR3  P.waltlii mRNA for fibroblast growth f...   188  2e-45
ref|NM_000142.2|  Homo sapiens fibroblast growth factor rece...   188  2e-45
emb|X77251.1|GGTRKBRFL  G.gallus trkB receptor mRNA (full le...   188  2e-45
emb|Z35139.1|RRFIBGFC  R.rattus mRNA for fibroblast growth f...   188  2e-45
ref|NM_022965.1|  Homo sapiens fibroblast growth factor rece...   188  2e-45
gb|M64347.1|HUMFGFLR  Human novel growth factor receptor mRN...   188  2e-45
emb|X74030.1|DMDFR1  D.melanogaster mRNA for DFR1 protein (F...   188  2e-45
gb|M35195.1|CHKCEK2  Chicken tyrosine kinase (cek2) mRNA, co...   188  2e-45
emb|X74109.1|GDTRKB  G.domesticus trkB mRNA                       188  2e-45
gb|K01690.1|ACSGAGFPS  Avian sarcoma virus retroviral oncoge...   187  3e-45
emb|X61992.1|GGBEK  G.gallus mRNA bek for receptor tyrosine ...   187  3e-45
emb|X89807.1|XLFGFREC4  X.laevis mRNA for FGF receptor 4          187  3e-45
dbj|AB059430.1|AB059430  Bos taurus fgfr3 mRNA for fibroblas...   187  3e-45
emb|X65943.1|XLFGFR2  X.laevis mRNA for fibroblast growth fa...   187  3e-45
gb|L21707.1|MUSMRK  Mus musculus receptor tyrosine kinase (M...   187  3e-45
ref|NM_008523.1|  Mus musculus leukocyte tyrosine kinase (Lt...   187  4e-45
emb|X52621.1|MMLTK2  Mouse ltk mRNA for leukocyte tyrosine k...   187  4e-45
gb|M90470.1|MUSLTK  Mus musculus leukocyte tyrosine kinase (...   187  4e-45
gb|L43620.1|XELERTK  Xenopus laevis (clone TCK) Eph receptor...   187  4e-45
emb|X17647.1|MSTRKB  Murine trkB mRNA for tyrosine protein k...   187  4e-45
emb|X07984.1|MMLTK  M.musculus mRNA for leukocyte tyrosine k...   187  4e-45
gb|AF410899.1|AF410899  Homo sapiens neurotrophin receptor t...   187  5e-45
ref|NM_006180.1|  Homo sapiens neurotrophic tyrosine kinase,...   187  5e-45
gb|U12140.1|HSU12140  Human tyrosine kinase receptor p145TRK...   187  5e-45
dbj|AB030078.1|AB030078  Homo sapiens mRNA for K-sam-IIO3, c...   187  5e-45
gb|AF400441.1|AF400441  Homo sapiens neurotrophic tyrosine k...   187  5e-45
gb|S76473.1|S76473  trkB [human, brain, mRNA, 3194 nt]            187  5e-45
gb|M14778.1|DROINSLR  D.melanogaster insulin-like receptor m...   187  5e-45
dbj|AB030073.1|AB030073  Homo sapiens mRNA for K-sam-IIH1, c...   187  5e-45
ref|XM_005486.4|  Homo sapiens neurotrophic tyrosine kinase,...   187  5e-45
dbj|AB030074.1|AB030074  Homo sapiens mRNA for K-sam-IIH2, p...   187  5e-45
dbj|AB030076.1|AB030076  Homo sapiens mRNA for K-sam-IIO1, c...   187  5e-45
dbj|AB030077.1|AB030077  Homo sapiens mRNA for K-sam-IIO2, c...   187  5e-45
dbj|AB030075.1|AB030075  Homo sapiens mRNA for K-sam-IIH3, c...   187  5e-45
ref|NM_012731.1|  Rattus norvegicus Neural receptor protein-...   186  7e-45
gb|M55291.1|RATTRKB1  Rat neural receptor protein-tyrosine k...   186  7e-45
emb|X93581.1|GGTRKA  G.gallus mRNA for trkA protein               186  7e-45
gb|L19870.1|NVIKGFR  Notophthalmus viridescens keratinocyte ...   186  7e-45
gb|L19869.1|NVI2FGFR  Notophthalmus viridescens fibroblast g...   186  7e-45
emb|Z35138.1|RRFIBGFB  R.rattus mRNA for fibroblast growth f...   186  7e-45
gb|AF053632.1|AF053632  Danio rerio endothelium-specific rec...   186  7e-45
ref|NM_005607.1|  Homo sapiens PTK2 protein tyrosine kinase ...   186  9e-45
gb|L05186.1|HUMFAK  Homo sapiens focal adhesion kinase mRNA,...   186  9e-45
gb|S59184.1|S59184  RYK=related to receptor tyrosine kinase ...   185  2e-44
gb|J02087.1|FCGGAONC  feline sarcoma virus (gardner-arnstein...   185  2e-44
emb|Y17877.1|SRA17877  Sycon raphanus mRNA for insulin recep...   185  2e-44
ref|NM_002031.1|  Homo sapiens fyn-related kinase (FRK), mRNA     184  3e-44
gb|U00803.1|HSU00803  Human SRC-like tyrosine kinase (FRK) m...   184  3e-44
ref|NM_008011.1|  Mus musculus fibroblast growth factor rece...   184  3e-44
emb|X59927.1|MMFGFR4M  M.musculus mRNA for fibroblast growth...   184  3e-44
gb|M80800.1|PIGTRKC  Pig gp145-trkC (trkC) mRNA, complete cds     184  3e-44
gb|BC012916.1|BC012916  Homo sapiens, Similar to fyn-related...   184  3e-44
gb|U22322.1|HSU22322  Human nuclear tyrosine protein kinase ...   184  3e-44
emb|X74031.1|DMDFR2  D.melanogaster DFR2 gene for FGF-recept...   184  3e-44
gb|U39761.1|CEU39761  Caenorhabditis elegans FGF receptor (e...   184  3e-44
dbj|AB025537.1|AB025537  Branchiostoma belcheri mRNA for FGF...   184  3e-44
ref|NM_002530.1|  Homo sapiens neurotrophic tyrosine kinase,...   184  3e-44
gb|U05012.1|HSU05012  Human receptor tyrosine kinase TrkC (N...   184  3e-44
gb|AF033810.1|AF033810  Fujinami sarcoma virus, complete genome   184  3e-44
gb|J02194.1|ACF  Fujinami sarcoma virus (unintegrated circul...   184  3e-44
gb|M81342.1|MUSMFR3  BALB/c fibroblast growth factor recepto...   184  3e-44
gb|M14930.1|ACFTS140A  Fujinami sarcoma virus temperature se...   184  5e-44
gb|AF125808.1|AF125808  Homo sapiens ETS related protein-neu...   183  6e-44
ref|NM_019248.1|  Rattus norvegicus neurotrophic tyrosine ki...   183  6e-44
gb|L03813.1|RATTRKCN3  Rattus norvegicus neurotrophin-3 rece...   183  6e-44
gb|L14445.2|RATTRKCA  Rattus norvegicus tyrosine protein kin...   183  6e-44
gb|AF041811.2|AF041811  Homo sapiens ETS related protein-gro...   183  6e-44
gb|S62924.1|S62924  Rattus sp. receptor tyrosine kinase (Trk...   183  6e-44
gb|AF052184.1|AF052184  Homo sapiens clone 24817 mRNA sequence    183  6e-44
ref|NM_017318.1|  Rattus norvegicus cell adhesion kinase bet...   183  8e-44
dbj|D45854.1|D45854  Rattus norvegicus mRNA for CAK beta (ce...   183  8e-44
gb|AF065472.1|AF065472  Hydra vulgaris non-receptor protein-...   183  8e-44
gb|S80542.1|S80542  related adhesion focal tyrosine kinase=i...   183  8e-44
ref|NM_004103.1|  Homo sapiens protein tyrosine kinase 2 bet...   183  8e-44
gb|U33284.1|HSU33284  Human protein tyrosine kinase PYK2 mRN...   183  8e-44
ref|XM_027440.2|  Homo sapiens protein tyrosine kinase 2 bet...   183  8e-44
gb|L49207.1|HUMFAK2R  Homo sapiens (clone B6a) focal adhesio...   183  8e-44
gb|U69109.1|RNU69109  Rattus norvegicus calcium-dependent ty...   183  8e-44
gb|U43522.1|HSU43522  Human cell adhesion kinase beta (CAKbe...   183  8e-44
dbj|AB006565.3|AB006565  Ephydatia fluviatilis EfPTK56 mRNA ...   182  1e-43
emb|X52192.1|HSCFES  H.sapiens RNA for c-fes                      182  1e-43
ref|NM_076703.1|  protein-tyrosine kinase                         182  1e-43
ref|NM_076704.1|  Caenorhabditis elegans                          182  1e-43
gb|U39672.1|XLU39672  Xenopus laevis neurotrophin receptor B...   182  1e-43
emb|X16891.2|XSMTK  Xiphophorus mRNA for melanoma receptor k...   182  1e-43
gb|U53471.2|XXU53471  Xiphophorus xiphidium receptor tyrosin...   182  1e-43
gb|M22820.1|M22820  Figure 4. Nucleotide sequence of the pro...   182  1e-43
ref|NM_002005.2|  Homo sapiens feline sarcoma oncogene (FES)...   182  2e-43
gb|AF157560.1|AF157560  Danio rerio fibroblast growth factor...   182  2e-43
emb|X65059.1|PWFGFR4  P.waltlii mRNA for fibroblast growth f...   182  2e-43
gb|J02088.1|FCSSTONC  Feline sarcoma virus gag polyprotein g...   181  2e-43
ref|NM_024368.1|  Rattus norvegicus src related tyrosine kin...   180  5e-43
gb|U09583.1|RNU09583  Rattus norvegicus Sprague-Dawley src r...   180  5e-43
emb|X06704.1|HSTRK2H  Human mRNA for trk-2h oncogene              180  7e-43
ref|NM_002529.2|  Homo sapiens neurotrophic tyrosine kinase,...   180  7e-43
gb|AF216782.1|AF216782  Aplysia californica ror mRNA, comple...   180  7e-43
emb|X12616.1|MMFESCR  Mouse c-fes proto-oncogene mRNA for c-...   180  7e-43
emb|X61604.1|SLSRK4  S.lacustris srk4 mRNA for src-type tyro...   180  7e-43
gb|M23102.1|HUMTRKPOA  Human trk proto-oncogene insert of pLM6    180  7e-43
emb|X85960.1|HSTRKT3ON  H.sapiens TRK-T3 oncogene                 180  7e-43
emb|X62947.1|HSTRKT1  H.sapiens mRNA (TRK-T1) for 55 KD protein   180  7e-43
gb|AY058652.1|  Drosophila melanogaster LD35329 full length ...   179  1e-42
dbj|AB025536.1|AB025536  Lampetra reissneri mRNA for FGFR3/4...   179  1e-42
ref|NM_009539.1|  Mus musculus zeta-chain (TCR) associated p...   179  1e-42
gb|U04379.1|MMU04379  Mus musculus protein tyrosine kinase Z...   179  1e-42
dbj|D42125.1|D42125  Fruitfly mRNA for Dsrc41, complete cds       179  1e-42
gb|BC007137.1|BC007137  Mus musculus, B-cell src-homology ty...   179  1e-42
ref|NM_057501.1|  Drosophila melanogaster Src oncogene at 42...   179  1e-42
gb|M59814.1|RATELKF  Rattus norvegicus mRNA sequence              179  1e-42
emb|X13411.1|RNELK  Rat mRNA for elk protein                      179  1e-42
emb|X59669.1|GGTRKC  G.gallus trkC gene (truncated form)          179  1e-42
emb|X06943.1|REAEV34E  Avian Erythroblastosis Virus (ts34) v...   178  2e-42
>gb|U18933.1|MMU18933 Mus musculus receptor tyrosine kinase (Dtk) mRNA, complete cds
          Length = 3919

 Score = 1637 bits (4238), Expect = 0.0
 Identities = 810/880 (92%), Positives = 810/880 (92%)
 Frame = +3

Query: 1    MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
            MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGME
Sbjct: 213  MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME 392

Query: 61   DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
            DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
Sbjct: 393  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 572

Query: 121  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
            VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
Sbjct: 573  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 752

Query: 181  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
            NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
Sbjct: 753  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 932

Query: 241  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
            GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 933  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 1112

Query: 301  DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
            DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 1113 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1292

Query: 361  ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
            ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1293 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1472

Query: 421  PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1473 PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1652

Query: 481  IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
            IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1653 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1832

Query: 541  MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1833 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 2012

Query: 601  LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
            LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 2013 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2192

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2193 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2372

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2373 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2552

Query: 781  GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
            GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGER                IPSDSRYI
Sbjct: 2553 GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERSSSEAGDGSGVGAVGGIPSDSRYI 2732

Query: 841  FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
            FSPGGLSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2733 FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2852
>gb|U18342.1|MMU18342 Mus musculus putative growth factor receptor tyrosine kinase isoform
            A precursor (tyro3) mRNA, complete cds
          Length = 3907

 Score = 1637 bits (4238), Expect = 0.0
 Identities = 810/880 (92%), Positives = 810/880 (92%)
 Frame = +2

Query: 1    MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
            MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGME
Sbjct: 194  MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME 373

Query: 61   DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
            DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
Sbjct: 374  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 553

Query: 121  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
            VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
Sbjct: 554  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 733

Query: 181  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
            NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
Sbjct: 734  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 913

Query: 241  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
            GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 914  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 1093

Query: 301  DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
            DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 1094 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1273

Query: 361  ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
            ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1274 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1453

Query: 421  PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1454 PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1633

Query: 481  IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
            IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1634 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1813

Query: 541  MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1814 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 1993

Query: 601  LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
            LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 1994 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2173

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2174 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2353

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2354 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2533

Query: 781  GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
            GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGER                IPSDSRYI
Sbjct: 2534 GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERSSSEAGDGSGVGAVGGIPSDSRYI 2713

Query: 841  FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
            FSPGGLSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2714 FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2833
>dbj|AB000828.1|AB000828 Mouse mRNA for receptor tyrosine kinase, complete cds
          Length = 2845

 Score = 1637 bits (4238), Expect = 0.0
 Identities = 810/880 (92%), Positives = 810/880 (92%)
 Frame = +2

Query: 1   MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
           MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGME
Sbjct: 14  MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME 193

Query: 61  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
           DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
Sbjct: 194 DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 373

Query: 121 VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
           VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
Sbjct: 374 VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 553

Query: 181 NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
           NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
Sbjct: 554 NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 733

Query: 241 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
           GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 734 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 913

Query: 301 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
           DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 914 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1093

Query: 361 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
           ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1094ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1273

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
           PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1274PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1453

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
           IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1454IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1633

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
           MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1634MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 1813

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 1814LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 1993

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 1994VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2173

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2174TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2353

Query: 781 GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
           GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGER                IPSDSRYI
Sbjct: 2354GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERSSSEAGDGSGVGAVGGIPSDSRYI 2533

Query: 841 FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
           FSPGGLSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2534FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2653
>gb|U05683.1|MMU05683 Mus musculus receptor-type tyrosine kinase (rse) mRNA, complete cds
          Length = 3785

 Score = 1637 bits (4238), Expect = 0.0
 Identities = 810/880 (92%), Positives = 810/880 (92%)
 Frame = +2

Query: 1   MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
           MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGME
Sbjct: 62  MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME 241

Query: 61  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
           DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
Sbjct: 242 DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 421

Query: 121 VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
           VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
Sbjct: 422 VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 601

Query: 181 NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
           NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
Sbjct: 602 NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 781

Query: 241 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
           GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 782 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 961

Query: 301 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
           DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 962 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1141

Query: 361 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
           ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1142ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1321

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
           PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1322PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1501

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
           IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1502IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1681

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
           MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1682MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 1861

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 1862LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2041

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2042VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2221

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2222TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2401

Query: 781 GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
           GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGER                IPSDSRYI
Sbjct: 2402GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERSSSEAGDGSGVGAVGGIPSDSRYI 2581

Query: 841 FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
           FSPGGLSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2582FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2701
>gb|U18343.1|MMU18343 Mus musculus putative growth factor receptor tyrosine kinase isoform
            B (tyro3) mRNA, complete cds
          Length = 4450

 Score = 1634 bits (4231), Expect = 0.0
 Identities = 803/845 (95%), Positives = 803/845 (95%)
 Frame = +2

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
            MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK
Sbjct: 842  MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 1021

Query: 96   SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
            SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 1022 SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 1201

Query: 156  PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP
Sbjct: 1202 PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 1381

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
            AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL
Sbjct: 1382 AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 1561

Query: 276  RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
            RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV
Sbjct: 1562 RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 1741

Query: 336  IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
            IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW
Sbjct: 1742 IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 1921

Query: 396  SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
            SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1922 SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVLTALITAAALALILLRKRRKETRFGQAFD 2101

Query: 456  SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
            SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 2102 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 2281

Query: 516  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
            KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 2282 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 2461

Query: 576  VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
            VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY
Sbjct: 2462 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 2641

Query: 636  LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
            LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 2642 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2821

Query: 696  DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
            DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM
Sbjct: 2822 DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 3001

Query: 756  YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
            YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE
Sbjct: 3002 YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 3181

Query: 816  RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
            R                IPSDSRYIFSPGGLSESPGQLEQQPESPLNEN           
Sbjct: 3182 RSSSEAGDGSGVGAVGGIPSDSRYIFSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLL 3361

Query: 876  PHSSC 880
            PHSSC
Sbjct: 3362 PHSSC 3376
>ref|NM_019392.1| Mus musculus TYRO3 protein tyrosine kinase 3 (Tyro3), mRNA
          Length = 3309

 Score = 1634 bits (4230), Expect = 0.0
 Identities = 808/880 (91%), Positives = 809/880 (91%)
 Frame = +2

Query: 1    MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
            MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGME
Sbjct: 221  MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME 400

Query: 61   DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
            DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
Sbjct: 401  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 580

Query: 121  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
            VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
Sbjct: 581  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 760

Query: 181  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
            NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
Sbjct: 761  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 940

Query: 241  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
            GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 941  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 1120

Query: 301  DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
            DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 1121 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1300

Query: 361  ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
            ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1301 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1480

Query: 421  PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1481 PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1660

Query: 481  IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
            IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1661 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1840

Query: 541  MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1841 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 2020

Query: 601  LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
            LHAFLLASRIGENPFNLPLQTLVRFMVDI CGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 2021 LHAFLLASRIGENPFNLPLQTLVRFMVDIRCGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2200

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2201 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2380

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2381 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2560

Query: 781  GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
            GHLSVLSTSQDPLYINIERAEQPTESGSPE+HCGER                IPSDSRYI
Sbjct: 2561 GHLSVLSTSQDPLYINIERAEQPTESGSPEVHCGERSSSEAGDGSGVGAVGGIPSDSRYI 2740

Query: 841  FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
            FSPGGLSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2741 FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2860
>emb|X78103.1|MMTYRO3 M.musculus Tyro 3 mRNA for tyrosine kinase
          Length = 3309

 Score = 1634 bits (4230), Expect = 0.0
 Identities = 808/880 (91%), Positives = 809/880 (91%)
 Frame = +2

Query: 1    MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
            MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGME
Sbjct: 221  MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME 400

Query: 61   DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
            DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
Sbjct: 401  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 580

Query: 121  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
            VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
Sbjct: 581  VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 760

Query: 181  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
            NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
Sbjct: 761  NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 940

Query: 241  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
            GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 941  GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 1120

Query: 301  DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
            DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 1121 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1300

Query: 361  ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
            ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1301 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1480

Query: 421  PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1481 PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1660

Query: 481  IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
            IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1661 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1840

Query: 541  MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1841 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 2020

Query: 601  LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
            LHAFLLASRIGENPFNLPLQTLVRFMVDI CGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 2021 LHAFLLASRIGENPFNLPLQTLVRFMVDIRCGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2200

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2201 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2380

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2381 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2560

Query: 781  GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
            GHLSVLSTSQDPLYINIERAEQPTESGSPE+HCGER                IPSDSRYI
Sbjct: 2561 GHLSVLSTSQDPLYINIERAEQPTESGSPEVHCGERSSSEAGDGSGVGAVGGIPSDSRYI 2740

Query: 841  FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
            FSPGGLSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2741 FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2860
>ref|NM_017092.1| Rattus norvegicus Bruton agammaglobulinemia tyrosine kinase
           (Tyro3), mRNA
          Length = 3726

 Score = 1592 bits (4122), Expect = 0.0
 Identities = 787/880 (89%), Positives = 795/880 (89%)
 Frame = +2

Query: 1   MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
           MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGM+
Sbjct: 26  MALRRSMGRPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGMD 205

Query: 61  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
           DPDIHWMKDG VVQNASQVSISISE +WIGLLSLKS ERSDAGLYWCQVKDGEETKISQS
Sbjct: 206 DPDIHWMKDGAVVQNASQVSISISEQNWIGLLSLKSAERSDAGLYWCQVKDGEETKISQS 385

Query: 121 VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
           VWLTVEGVPFFTVEPKDLAVPPN PFQLSCEAVGPPEPVTI+WWRG TKVGGPA SPSVL
Sbjct: 386 VWLTVEGVPFFTVEPKDLAVPPNVPFQLSCEAVGPPEPVTIFWWRGPTKVGGPASSPSVL 565

Query: 181 NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
           NVTGVTQRTEFSCEA NIKGLATSRPAI+RLQAPPAAPFN TVTTISS NASVAWVPGAD
Sbjct: 566 NVTGVTQRTEFSCEAHNIKGLATSRPAIIRLQAPPAAPFNITVTTISSSNASVAWVPGAD 745

Query: 241 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
           GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 746 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 925

Query: 301 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
           DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 926 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1105

Query: 361 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
           ELMVEGT ANLTDWDPQKDL+LRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1106ELMVEGTTANLTDWDPQKDLVLRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1285

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
           PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1286PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1465

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
           IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1466IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1645

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
           MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1646MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 1825

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 1826LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2005

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2006VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2185

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPYAGIENAEIYNYLI GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2186TPYAGIENAEIYNYLISGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2365

Query: 781 GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
           GHLSVLSTSQDPLYINIERA QP E+GSPEL CGE+                IPSD RYI
Sbjct: 2366GHLSVLSTSQDPLYINIERAGQPAENGSPELPCGEQSSSEAGDGSGMGAIGGIPSDCRYI 2545

Query: 841 FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
           FSPGGL+ESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2546FSPGGLAESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2665
>dbj|D37880.1|RATSKY Rat mRNA for Sky, complete cds
          Length = 3726

 Score = 1592 bits (4122), Expect = 0.0
 Identities = 787/880 (89%), Positives = 795/880 (89%)
 Frame = +2

Query: 1   MALRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGAPVKMTVSQGQPVKLNCSVEGME 60
           MALRRSM                            MGAPVKMTVSQGQPVKLNCSVEGM+
Sbjct: 26  MALRRSMGRPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGMD 205

Query: 61  DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS 120
           DPDIHWMKDG VVQNASQVSISISE +WIGLLSLKS ERSDAGLYWCQVKDGEETKISQS
Sbjct: 206 DPDIHWMKDGAVVQNASQVSISISEQNWIGLLSLKSAERSDAGLYWCQVKDGEETKISQS 385

Query: 121 VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL 180
           VWLTVEGVPFFTVEPKDLAVPPN PFQLSCEAVGPPEPVTI+WWRG TKVGGPA SPSVL
Sbjct: 386 VWLTVEGVPFFTVEPKDLAVPPNVPFQLSCEAVGPPEPVTIFWWRGPTKVGGPASSPSVL 565

Query: 181 NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD 240
           NVTGVTQRTEFSCEA NIKGLATSRPAI+RLQAPPAAPFN TVTTISS NASVAWVPGAD
Sbjct: 566 NVTGVTQRTEFSCEAHNIKGLATSRPAIIRLQAPPAAPFNITVTTISSSNASVAWVPGAD 745

Query: 241 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 300
           GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
Sbjct: 746 GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG 925

Query: 301 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 360
           DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
Sbjct: 926 DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD 1105

Query: 361 ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 420
           ELMVEGT ANLTDWDPQKDL+LRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
Sbjct: 1106ELMVEGTTANLTDWDPQKDLVLRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV 1285

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
           PVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
Sbjct: 1286PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 1465

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
           IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
Sbjct: 1466IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 1645

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
           MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
Sbjct: 1646MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 1825

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
Sbjct: 1826LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 2005

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
Sbjct: 2006VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 2185

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPYAGIENAEIYNYLI GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 2186TPYAGIENAEIYNYLISGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 2365

Query: 781 GHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYI 840
           GHLSVLSTSQDPLYINIERA QP E+GSPEL CGE+                IPSD RYI
Sbjct: 2366GHLSVLSTSQDPLYINIERAGQPAENGSPELPCGEQSSSEAGDGSGMGAIGGIPSDCRYI 2545

Query: 841 FSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
           FSPGGL+ESPGQLEQQPESPLNEN           PHSSC
Sbjct: 2546FSPGGLAESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 2665
>ref|XM_007545.3| Homo sapiens TYRO3 protein tyrosine kinase (TYRO3), mRNA
          Length = 3794

 Score = 1464 bits (3791), Expect = 0.0
 Identities = 722/845 (85%), Positives = 746/845 (87%)
 Frame = +1

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
            MGAPVK+TVSQGQPVKLNCSVEGME+PDI W+KDG VVQN  Q+ I +SE  WIG LSLK
Sbjct: 196  MGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLK 375

Query: 96   SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
            SVERSDAG YWCQV+DG ET+ISQ VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 376  SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 555

Query: 156  PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            PEPVTI WWRG TK+GGPAPSPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA P
Sbjct: 556  PEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP 735

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
            AAPFN TVT +SS NASVAW+PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCLL
Sbjct: 736  AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLL 915

Query: 276  RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
            R+L PATNYSLRVRCANALGPSPY DWVPFQTKGLAPA APQN HAIRTDSGLILEWEEV
Sbjct: 916  RDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEV 1095

Query: 336  IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
            IPE P EGPLGPYKLSWVQ+NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPW
Sbjct: 1096 IPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPW 1275

Query: 396  SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
            SQPLVVSSHD AG+QGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1276 SQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFD 1455

Query: 456  SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
            SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 1456 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 1635

Query: 516  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
            KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 1636 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 1815

Query: 576  VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
            VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVDIACGMEY
Sbjct: 1816 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEY 1995

Query: 636  LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
            LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 1996 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2175

Query: 696  DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
            DNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECME+VYDLM
Sbjct: 2176 DNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLM 2355

Query: 756  YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
            YQCWSADPKQRPSFTCLRMELENILG LSVLS SQDPLYINIERAE+PT  GS EL   +
Sbjct: 2356 YQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRD 2535

Query: 816  RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
            +                 PSD RYI +PGGL+E PGQ E QPESPLNE            
Sbjct: 2536 QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLL 2715

Query: 876  PHSSC 880
            PHSSC
Sbjct: 2716 PHSSC 2730
>dbj|D17517.1|HUMSKY Human sky mRNA for Sky, complete cds
          Length = 3949

 Score = 1464 bits (3791), Expect = 0.0
 Identities = 722/845 (85%), Positives = 746/845 (87%)
 Frame = +3

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
            MGAPVK+TVSQGQPVKLNCSVEGME+PDI W+KDG VVQN  Q+ I +SE  WIG LSLK
Sbjct: 360  MGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLK 539

Query: 96   SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
            SVERSDAG YWCQV+DG ET+ISQ VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 540  SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 719

Query: 156  PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            PEPVTI WWRG TK+GGPAPSPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA P
Sbjct: 720  PEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP 899

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
            AAPFN TVT +SS NASVAW+PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCLL
Sbjct: 900  AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLL 1079

Query: 276  RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
            R+L PATNYSLRVRCANALGPSPY DWVPFQTKGLAPA APQN HAIRTDSGLILEWEEV
Sbjct: 1080 RDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEV 1259

Query: 336  IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
            IPE P EGPLGPYKLSWVQ+NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPW
Sbjct: 1260 IPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPW 1439

Query: 396  SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
            SQPLVVSSHD AG+QGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1440 SQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFD 1619

Query: 456  SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
            SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 1620 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 1799

Query: 516  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
            KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 1800 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 1979

Query: 576  VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
            VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVDIACGMEY
Sbjct: 1980 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEY 2159

Query: 636  LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
            LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 2160 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2339

Query: 696  DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
            DNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECME+VYDLM
Sbjct: 2340 DNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLM 2519

Query: 756  YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
            YQCWSADPKQRPSFTCLRMELENILG LSVLS SQDPLYINIERAE+PT  GS EL   +
Sbjct: 2520 YQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRD 2699

Query: 816  RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
            +                 PSD RYI +PGGL+E PGQ E QPESPLNE            
Sbjct: 2700 QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLL 2879

Query: 876  PHSSC 880
            PHSSC
Sbjct: 2880 PHSSC 2894
>gb|U05682.1|HSU05682 Human receptor-type tyrosine kinase (rse) mRNA, complete cds
          Length = 3611

 Score = 1464 bits (3791), Expect = 0.0
 Identities = 722/845 (85%), Positives = 746/845 (87%)
 Frame = +1

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
           MGAPVK+TVSQGQPVKLNCSVEGME+PDI W+KDG VVQN  Q+ I +SE  WIG LSLK
Sbjct: 142 MGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLK 321

Query: 96  SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
           SVERSDAG YWCQV+DG ET+ISQ VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 322 SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 501

Query: 156 PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
           PEPVTI WWRG TK+GGPAPSPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA P
Sbjct: 502 PEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP 681

Query: 216 AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
           AAPFN TVT +SS NASVAW+PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCLL
Sbjct: 682 AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLL 861

Query: 276 RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
           R+L PATNYSLRVRCANALGPSPY DWVPFQTKGLAPA APQN HAIRTDSGLILEWEEV
Sbjct: 862 RDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEV 1041

Query: 336 IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
           IPE P EGPLGPYKLSWVQ+NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPW
Sbjct: 1042IPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPW 1221

Query: 396 SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
           SQPLVVSSHD AG+QGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1222SQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFD 1401

Query: 456 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
           SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 1402SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 1581

Query: 516 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
           KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 1582KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 1761

Query: 576 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
           VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVDIACGMEY
Sbjct: 1762VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEY 1941

Query: 636 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
           LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 1942LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2121

Query: 696 DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
           DNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECME+VYDLM
Sbjct: 2122DNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLM 2301

Query: 756 YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
           YQCWSADPKQRPSFTCLRMELENILG LSVLS SQDPLYINIERAE+PT  GS EL   +
Sbjct: 2302YQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRD 2481

Query: 816 RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
           +                 PSD RYI +PGGL+E PGQ E QPESPLNE            
Sbjct: 2482QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLL 2661

Query: 876 PHSSC 880
           PHSSC
Sbjct: 2662PHSSC 2676
>ref|NM_006293.1| Homo sapiens TYRO3 protein tyrosine kinase (TYRO3), mRNA
          Length = 4364

 Score = 1464 bits (3790), Expect = 0.0
 Identities = 722/845 (85%), Positives = 746/845 (87%)
 Frame = +1

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
            MGAPVK+TVSQGQPVKLNCSVEGME+PDI W+KDG VVQN  Q+ I +SE  WIG LSLK
Sbjct: 766  MGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLK 945

Query: 96   SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
            SVERSDAG YWCQV+DG ET+ISQ VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 946  SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 1125

Query: 156  PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            PEPVTI WWRG TK+GGPAPSPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA P
Sbjct: 1126 PEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP 1305

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
            AAPFN TVT +SS NASVAW+PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCLL
Sbjct: 1306 AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLL 1485

Query: 276  RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
            R+L PATNYSLRVRCANALGPSPY DWVPFQTKGLAPA APQN HAIRTDSGLILEWEEV
Sbjct: 1486 RDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEV 1665

Query: 336  IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
            IPE P EGPLGPYKLSWVQ+NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPW
Sbjct: 1666 IPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPW 1845

Query: 396  SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
            SQPLVVSSHD AG+QGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1846 SQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFD 2025

Query: 456  SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
            SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 2026 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 2205

Query: 516  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
            KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 2206 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 2385

Query: 576  VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
            VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVDIACGMEY
Sbjct: 2386 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEY 2565

Query: 636  LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
            LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 2566 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2745

Query: 696  DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
            DNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECME+VYDLM
Sbjct: 2746 DNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLM 2925

Query: 756  YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
            YQCWSADPKQRPSFTCLRMELENILG LSVLS SQDPLYINIERAE+PT  GS EL   +
Sbjct: 2926 YQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTVGGSLELPGRD 3105

Query: 816  RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
            +                 PSD RYI +PGGL+E PGQ E QPESPLNE            
Sbjct: 3106 QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLL 3285

Query: 876  PHSSC 880
            PHSSC
Sbjct: 3286 PHSSC 3300
>gb|U18934.1|HSU18934 Human receptor tyrosine kinase (DTK) mRNA, complete cds
          Length = 4364

 Score = 1464 bits (3790), Expect = 0.0
 Identities = 722/845 (85%), Positives = 746/845 (87%)
 Frame = +1

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
            MGAPVK+TVSQGQPVKLNCSVEGME+PDI W+KDG VVQN  Q+ I +SE  WIG LSLK
Sbjct: 766  MGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLK 945

Query: 96   SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
            SVERSDAG YWCQV+DG ET+ISQ VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 946  SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 1125

Query: 156  PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            PEPVTI WWRG TK+GGPAPSPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA P
Sbjct: 1126 PEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP 1305

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
            AAPFN TVT +SS NASVAW+PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCLL
Sbjct: 1306 AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLL 1485

Query: 276  RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
            R+L PATNYSLRVRCANALGPSPY DWVPFQTKGLAPA APQN HAIRTDSGLILEWEEV
Sbjct: 1486 RDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEV 1665

Query: 336  IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
            IPE P EGPLGPYKLSWVQ+NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPW
Sbjct: 1666 IPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPW 1845

Query: 396  SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
            SQPLVVSSHD AG+QGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1846 SQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFD 2025

Query: 456  SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
            SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 2026 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 2205

Query: 516  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
            KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 2206 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 2385

Query: 576  VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
            VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVDIACGMEY
Sbjct: 2386 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEY 2565

Query: 636  LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
            LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 2566 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2745

Query: 696  DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
            DNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECME+VYDLM
Sbjct: 2746 DNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLM 2925

Query: 756  YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
            YQCWSADPKQRPSFTCLRMELENILG LSVLS SQDPLYINIERAE+PT  GS EL   +
Sbjct: 2926 YQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTVGGSLELPGRD 3105

Query: 816  RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
            +                 PSD RYI +PGGL+E PGQ E QPESPLNE            
Sbjct: 3106 QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLL 3285

Query: 876  PHSSC 880
            PHSSC
Sbjct: 3286 PHSSC 3300
>dbj|D50479.1|D50479 Homo sapiens mRNA for protein-tyrosine kinase, complete cds
          Length = 2779

 Score = 1456 bits (3769), Expect = 0.0
 Identities = 719/845 (85%), Positives = 742/845 (87%)
 Frame = +3

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
           MGAPVK+TVSQGQPVKLNCSVEGME+PDI W+KDG VVQN  Q+ I +SE  WIG LSLK
Sbjct: 132 MGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLK 311

Query: 96  SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 155
           SVERSDAG YWCQV+DG ET+ISQ VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP
Sbjct: 312 SVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGP 491

Query: 156 PEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
           PEPVTI WWRG TK+GGPAPSPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA P
Sbjct: 492 PEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALP 671

Query: 216 AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLL 275
           AAPFN TVT +SS NASVAW+PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCL 
Sbjct: 672 AAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLF 851

Query: 276 RNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEV 335
           R+L PAT YSLRVRCANALGPSPY DWVPFQTKGLAPA APQN HAIRTDSGLIL WEEV
Sbjct: 852 RDLVPATIYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILVWEEV 1031

Query: 336 IPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPW 395
           IPE P EGPLGPYKLSWVQ+NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPW
Sbjct: 1032IPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPW 1211

Query: 396 SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
           SQPLVVSSHD AG+QGPPHSRTSWVPVVLGV               RKRRKETRFGQAFD
Sbjct: 1212SQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFD 1391

Query: 456 SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 515
           SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG
Sbjct: 1392SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLG 1571

Query: 516 KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
           KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG
Sbjct: 1572KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 1751

Query: 576 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
           VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVDIACGMEY
Sbjct: 1752VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEY 1931

Query: 636 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
           LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA
Sbjct: 1932LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 2111

Query: 696 DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
           DNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECME+VYDLM
Sbjct: 2112DNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLM 2291

Query: 756 YQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGE 815
           YQCWSADPKQRPSFTCLRMELENILG LSVLS SQDPLYINIERAE PT  GS EL   +
Sbjct: 2292YQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEDPTAGGSLELPGRD 2471

Query: 816 RXXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNENXXXXXXXXXXX 875
           +                 PSD RYI +PGGL+E PGQ E QPESPLNE            
Sbjct: 2472QPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLL 2651

Query: 876 PHSSC 880
           PHSSC
Sbjct: 2652PHSSC 2666
>dbj|D17393.1|MUSPTKAA Mouse mRNA for protein tyrosine kinase, complete cds
          Length = 4418

 Score = 1438 bits (3723), Expect(2) = 0.0
 Identities = 721/812 (88%), Positives = 731/812 (89%), Gaps = 1/812 (0%)
 Frame = +2

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK 95
            MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMK G       +  + + + + +  L+  
Sbjct: 827  MGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMK-GWHRGPECKPGVHLHQRAQLDWLTQP 1003

Query: 96   SVE-RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVG 154
             V   SDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAV PNAPFQLSCEAVG
Sbjct: 1004 KVSGASDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVQPNAPFQLSCEAVG 1183

Query: 155  PPEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAP 214
            PPEPVTIYWWRGLTKVGGPAP P VLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAP
Sbjct: 1184 PPEPVTIYWWRGLTKVGGPAPFPFVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAP 1363

Query: 215  PAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCL 274
            PAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCL
Sbjct: 1364 PAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCL 1543

Query: 275  LRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEE 334
            LRNLAPATNYSLRVRCANALGPSP         KG + A   +       DSGLILEWEE
Sbjct: 1544 LRNLAPATNYSLRVRCANALGPSPTRLGA-LSDKGPSAAELLRISMPFVPDSGLILEWEE 1720

Query: 335  VIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGP 394
            VIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGP
Sbjct: 1721 VIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGP 1900

Query: 395  WSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAF 454
            WSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGV               RKRRKETRFGQAF
Sbjct: 1901 WSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVLTALITAAALALILLRKRRKETRFGQAF 2080

Query: 455  DSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRML 514
            DSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRML
Sbjct: 2081 DSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRML 2260

Query: 515  GKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            GKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV
Sbjct: 2261 GKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 2440

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGME 634
            GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDI CGME
Sbjct: 2441 GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIRCGME 2620

Query: 635  YLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESL 694
            YLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESL
Sbjct: 2621 YLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESL 2800

Query: 695  ADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDL 754
            ADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDL
Sbjct: 2801 ADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDL 2980

Query: 755  MYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCG 814
            MYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDP YINIERAEQPTESGSPEL CG
Sbjct: 2981 MYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPFYINIERAEQPTESGSPELDCG 3160

Query: 815  ERXXXXXXXXXXXXXXXXIPSDSRYIFSPGGL 846
            ER                IPSDSRYIFSPG +
Sbjct: 3161 ERSSSEAGDGSGVGAVGGIPSDSRYIFSPGAI 3256
 Score = 50.4 bits (119), Expect(2) = 0.0
 Identities = 24/35 (68%), Positives = 24/35 (68%)
 Frame = +3

Query: 846  LSESPGQLEQQPESPLNENXXXXXXXXXXXPHSSC 880
            LSESPGQLEQQPESPLNEN           PHSSC
Sbjct: 3252 LSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC 3356
>gb|U02566.1|HSU02566 Human receptor tyrosine kinase tif mRNA, partial cds
          Length = 3031

 Score = 1191 bits (3082), Expect = 0.0
 Identities = 596/688 (86%), Positives = 612/688 (88%)
 Frame = +3

Query: 176 SPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAW 235
           SPSVLNVTGVTQ T FSCEA N+KGLA+SR A V LQA PAAPFN TVT +SS NASVAW
Sbjct: 3   SPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSNASVAW 182

Query: 236 VPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALG 295
           +PGADG ALL SCTVQV  APG WE LAVVVPVPPFTCLLR+L PATNYSLRVRCANALG
Sbjct: 183 MPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRCANALG 362

Query: 296 PSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQE 355
           PSPY DWVPFQTKGLAPA APQN HAIRTDSGLILEWEEVIPE P EGPLGPYKLSWVQ+
Sbjct: 363 PSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKLSWVQD 542

Query: 356 NGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHS 415
           NGTQDEL VEGTRANLT WDPQKDLI+RVC SNA+G GPWSQPLVVSSHD AG+QGPPHS
Sbjct: 543 NGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHS 722

Query: 416 RTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNR 475
           RTSWVPVVLGV               RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNR
Sbjct: 723 RTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNR 902

Query: 476 ERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFV 535
           ERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFV
Sbjct: 903 ERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFV 1082

Query: 536 KVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPF 595
           KVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPF
Sbjct: 1083KVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPF 1262

Query: 596 MKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAE 655
           MKHGDLHAFLLASRIGENPFNLPLQTL+RFMVD  CGMEYLSSRNFIHRDLAARNCMLAE
Sbjct: 1263MKHGDLHAFLLASRIGENPFNLPLQTLIRFMVD-TCGMEYLSSRNFIHRDLAARNCMLAE 1439

Query: 656 DMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEI 715
           DMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTV SDVWAFGVTMWEI
Sbjct: 1440DMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEI 1619

Query: 716 MTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRME 775
           MTRGQTPYAGIENAEIYNYLIGGN LKQPPECME+VYDLMYQCWSADPKQRPSFTCLRME
Sbjct: 1620MTRGQTPYAGIENAEIYNYLIGGN-LKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRME 1796

Query: 776 LENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPS 835
           LENILG LSVLS SQDPLYINIERAE+PT  GS EL   ++                 PS
Sbjct: 1797LENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPS 1976

Query: 836 DSRYIFSPGGLSESPGQLEQQPESPLNE 863
           D RYI +PGGL+E PGQ E QPESPLNE
Sbjct: 1977DCRYILTPGGLAEQPGQAEHQPESPLNE 2060
>gb|U70045.1|GGU70045 Gallus gallus Axl-related receptor tyrosine kinase (rek) mRNA,
            complete cds
          Length = 4961

 Score = 1082 bits (2799), Expect = 0.0
 Identities = 540/828 (65%), Positives = 635/828 (76%)
 Frame = +1

Query: 37   GAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKS 96
            G+P+K+ VSQGQPVKLNCS+EGMEDP++ W+KDG VVQ+  QV I + E  WIG LSLKS
Sbjct: 331  GSPIKLKVSQGQPVKLNCSLEGMEDPEMLWIKDGAVVQSVDQVYIPVDEDHWIGFLSLKS 510

Query: 97   VERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPP 156
            VER+D+G YWCQV++G + + SQ VWL VEGVP+FTVEP+D++V PNAPF ++C AVGPP
Sbjct: 511  VERTDSGKYWCQVENGGKKEESQQVWLIVEGVPYFTVEPEDVSVSPNAPFHMACAAVGPP 690

Query: 157  EPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPA 216
            EPVTI WW G ++VG P  SPS+LNV+G+ Q T FSCEA N+KGL++SR A V+++A P 
Sbjct: 691  EPVTIVWWMGDSRVGLPDISPSILNVSGINQSTMFSCEAHNVKGLSSSRTATVQIKAMPL 870

Query: 217  APFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLR 276
             P N TV+ ++S NASV WVPG DG A LHSCT+QVA +P   E    V PVPPF   ++
Sbjct: 871  PPLNVTVSQVTSSNASVVWVPGFDGRAPLHSCTLQVAESPDGQEVSTEVAPVPPFAYGVQ 1050

Query: 277  NLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVI 336
             L  +TNYS+RV+C+N +G SP+ + V FQT  LAP+  PQN H I+ D GL+LEWE V 
Sbjct: 1051 GLKHSTNYSVRVQCSNEMGSSPFTERVYFQTLELAPSSTPQNIHVIQRDPGLVLEWEGVA 1230

Query: 337  PEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWS 396
            P+   E  LG Y+L W+Q+N TQ E++V+ T+ANLT W+P KDLI+RVC  N+ G GPWS
Sbjct: 1231 PDVLKENVLG-YRLEWIQDNVTQGEMIVQDTKANLTTWNPLKDLIIRVCVLNSAGCGPWS 1407

Query: 397  QPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDS 456
               ++ + +  G Q  P   TSWVPV LG+               RKRRKETRFG AF S
Sbjct: 1408 DLFLLEAQEVMGGQRQPPYGTSWVPVALGILTALVTAVALALILLRKRRKETRFGHAFGS 1587

Query: 457  VMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGK 516
            V+ RG+PAVHFRAARSFNRE PE IEATL+S+GISDELK KL+DVLI EQQFTLGRMLGK
Sbjct: 1588 VVGRGDPAVHFRAARSFNREGPELIEATLESVGISDELKTKLKDVLIQEQQFTLGRMLGK 1767

Query: 517  GEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGV 576
            GEFGSVREA LK +DGSF KVAVKMLKADI  S+DIEEFLREAACMKEFDHPHV KL+GV
Sbjct: 1768 GEFGSVREALLKLDDGSFQKVAVKMLKADIFTSTDIEEFLREAACMKEFDHPHVTKLIGV 1947

Query: 577  SLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYL 636
            SLRSR KGRLPIPMVILPFMKHGDLHAFLL SRIGENPFNLPLQTL++FM+DIA GMEYL
Sbjct: 1948 SLRSRPKGRLPIPMVILPFMKHGDLHAFLLMSRIGENPFNLPLQTLLKFMIDIASGMEYL 2127

Query: 637  SSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLAD 696
            SS+NFIHRDLAARNCML E+M V VADFGLS+KIYSGDYYRQGCASKLPVKWLALESLAD
Sbjct: 2128 SSKNFIHRDLAARNCMLDENMNVSVADFGLSKKIYSGDYYRQGCASKLPVKWLALESLAD 2307

Query: 697  NLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMY 756
            NLYT HSDVWAFGVTMWEI+TRGQTPYAGIENAEIYNYLI GNRLKQPPEC+E+VYDLM 
Sbjct: 2308 NLYTTHSDVWAFGVTMWEIVTRGQTPYAGIENAEIYNYLISGNRLKQPPECLEDVYDLMC 2487

Query: 757  QCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPELHCGER 816
            +CW  +PK RPSF  LR +LE I G +S LS SQDPLY+NI + ++ + S  P +H    
Sbjct: 2488 RCWHPEPKLRPSFGVLRSQLEMIRGRMSTLSLSQDPLYVNIGKDKESSVS-DPAVHT-SF 2661

Query: 817  XXXXXXXXXXXXXXXXIPSDSRYIFSPGGLSESPGQLEQQPESPLNEN 864
                            I SD RYI SP  L +   + E+ PE    EN
Sbjct: 2662 GNTDGDETIAGAAAAAITSDYRYIMSPLCLGDDV-EGERHPEGQEGEN 2802
>gb|AF021344.1|AF021344 Danio rerio developmental receptor tyrosine kinase (Dtk) mRNA,
            complete cds
          Length = 3527

 Score =  737 bits (1902), Expect = 0.0
 Identities = 400/823 (48%), Positives = 513/823 (61%), Gaps = 18/823 (2%)
 Frame = +2

Query: 39   PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
            P   TV+QG  V+L C+ EG+ +P+I WMKDG  + +  Q+ I++  + W    S+KSV+
Sbjct: 290  PFHQTVTQGNMVRLGCAFEGLSEPEIIWMKDGEKLFSTDQMYITLDPYHWETFHSVKSVQ 469

Query: 99   RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
            + DAG YWC+V+       S+  W+TV GVP F VEP+D+A      F L+C A GPPEP
Sbjct: 470  QQDAGKYWCEVEYHGAIISSEPAWITVAGVPHFGVEPEDVAAFAGESFNLTCAASGPPEP 649

Query: 159  VTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAP 218
            V + WW G  + G   PSPSVL V GV +  +F CE RN +G++ SR   V ++A P + 
Sbjct: 650  VEVLWWLGGEQNGDFTPSPSVLFVKGVNESIKFHCEPRNARGISVSRTGTVHIKARPDS- 826

Query: 219  FNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNL 278
               T   +S +N ++ W PG  G + L +CT+Q++  PGE +   VVV VPPF  +   L
Sbjct: 827  LGRTGHHVSDFNITLTWSPGFTGHSQLSTCTIQLSRGPGEVKLPDVVVEVPPFQHVFEGL 1006

Query: 279  APATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPE 338
               +NYS+RVRC N +G SP+  WV F T   AP+ AP+NF    ++  L L W  +  E
Sbjct: 1007 RSYSNYSVRVRCDNEVGSSPFSPWVDFHTPQAAPSAAPKNFTFDLSEQQLTLSWATLEQE 1186

Query: 339  DPG-------EGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIG 391
            +          G L  YKL W Q   +QD L+ +   A+L+      +   +V A    G
Sbjct: 1187 ELRGRLQEELRGRLLAYKLQWNQGGESQDPLLFKENVAHLSGAGRFFNATFQVAACTMAG 1366

Query: 392  DGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFG 451
             GPWSQP++V     +  Q        WV ++ G+               R R KET+FG
Sbjct: 1367 CGPWSQPVLVMPV--SAMQAQTQRGHMWVGLLFGLLVATMVGLLLIVLI-RNRGKETQFG 1537

Query: 452  QAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLG 511
             AF +  A  E  V F AARSFNR+ PE  E+TLDSLGI+ +LK KL+DVLI E+  TLG
Sbjct: 1538 SAFAAQGA--EVPVSFTAARSFNRQFPELPESTLDSLGINSDLKAKLQDVLIFERLLTLG 1711

Query: 512  RMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVA 571
            RMLGKGEFGSVREA LK E+ S  KVAVK+LK DI +SSDIE+ L+EAA MK+F HP+V 
Sbjct: 1712 RMLGKGEFGSVREAFLKSENNSGQKVAVKVLKTDINSSSDIEQCLKEAAYMKDFHHPNVI 1891

Query: 572  KLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIAC 631
            +L+GVSL  RA+ RLPIPMVILPFMKHGDLH FLL SR+G+ PF +  Q L++FM+DIA 
Sbjct: 1892 QLIGVSLHRRAQQRLPIPMVILPFMKHGDLHTFLLMSRLGDEPFTVSQQILIQFMLDIAR 2071

Query: 632  GMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLAL 691
            GMEYLS++N IHRDLAARNCML E+M+VCVADFGLS+KIYSGDYYRQG  SKLPVKW+AL
Sbjct: 2072 GMEYLSNKNIIHRDLAARNCMLNENMSVCVADFGLSKKIYSGDYYRQGSVSKLPVKWIAL 2251

Query: 692  ESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEV 751
            ESLADN+YT  SDVWAFGVTMWEIMTRGQTPY G+EN+EIY YLI G RLKQPP+C  ++
Sbjct: 2252 ESLADNVYTTQSDVWAFGVTMWEIMTRGQTPYPGVENSEIYEYLIKGERLKQPPDCPADI 2431

Query: 752  YDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIE-----------RA 800
            Y++M+ CWS  PK RPSF  L  +LE +   L+     +  LY+N+E           R+
Sbjct: 2432 YEIMHSCWSPVPKCRPSFQHLIDQLELLWAKLNPAPVKEPLLYVNLEEEDGEQANSGTRS 2611

Query: 801  EQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDSRYIFSP 843
             +    G P    G                  I  D RYI  P
Sbjct: 2612 SEEPSWGVPWQCAGIEEDEKDWLMVSSGAALAIGGDYRYIIGP 2740
>dbj|AB067527.1|AB067527 Rattus norvegicus axl gene for rat Axl shortform, complete cds
          Length = 2640

 Score =  642 bits (1657), Expect = 0.0
 Identities = 353/789 (44%), Positives = 482/789 (60%), Gaps = 26/789 (3%)
 Frame = +1

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQNA--SQVSISISEH---SW- 88
           +G P  +T ++G    L C ++   E P++ W++DG +++ A  +Q  + + E     W 
Sbjct: 94  VGNPGNITGARGLTGTLRCELQVQGEPPEVMWLRDGQILELADNTQTQVPLGEDWQDEWK 273

Query: 89  -IGLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L + +++ SDAG Y C V     T +SQ  ++ +EG+P+F  EP+D AVP N PF 
Sbjct: 274 VVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFN 453

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPVT+ W +    L  V G +   S L   G+ + + FSCEA N KG+ TS
Sbjct: 454 LSCQAQGPPEPVTLLWLQDAVPLAPVAGYSFQHS-LQAPGLNKTSSFSCEAHNAKGVTTS 630

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVA---HAPGEW-- 259
           R A + +   P  P N  V +       VAW+P   G+  L  CT+Q        G W  
Sbjct: 631 RTATITVL--PQRPHNLHVVSRHPTELEVAWIPTLSGIYPLTHCTLQAVLSNDGVGVWLG 804

Query: 260 ------EALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPA 313
                 E L V V VPP    L  L P T Y +RV C ++ GPSP+  W+P +T    P 
Sbjct: 805 KSDPPEEPLTVQVSVPPHQLRLEKLLPHTPYHIRVSCTSSQGPSPWTHWLPVETTEGVPL 984

Query: 314 RAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT- 372
             P+N  A+R  S  ++ W+E  P +P +G L  Y+L++  ++ T + LM  G    +T 
Sbjct: 985 GPPENVSAMRNGSQALVRWQE--PREPLQGTLLGYRLAYRGQD-TPEVLMDIGLTREVTL 1155

Query: 373 ---DWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXX 429
                 P  +L + V A  + GDGPWS P+ +          PP     W  V+LG    
Sbjct: 1156ELRGDRPVANLTVSVAAYTSAGDGPWSLPVPLEPWRPVSEPPPPAFSWPWWYVLLGALVA 1335

Query: 430 XXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLG 489
                        +R+KETR+G+ F+  + RGE  V +RA +S++R   E   ATL+SLG
Sbjct: 1336AACVLILTLFLVHRRKKETRYGEVFEPTVERGELVVRYRARKSYSRRTTE---ATLNSLG 1506

Query: 490 ISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIAS 549
           IS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK +K  I   
Sbjct: 1507ISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVKTMKIAICTR 1683

Query: 550 SDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR 609
           S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGDLH+FLL SR
Sbjct: 1684SELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSR 1863

Query: 610 IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
           +G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VCVADFGLS+K
Sbjct: 1864LGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKK 2043

Query: 670 IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
           IY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQTPY G+EN+
Sbjct: 2044IYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENS 2223

Query: 730 EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTS 789
           EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSF  LR +LEN L  L      
Sbjct: 2224EIYDYLRQGNRLKQPLDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEP 2403

Query: 790 QDPLYINIE 798
            + LY+N++
Sbjct: 2404DEILYVNMD 2430
>dbj|AB067526.1|AB067526 Rattus norvegicus axl gene for rat Axl longform, complete cds
          Length = 2667

 Score =  639 bits (1647), Expect = 0.0
 Identities = 354/798 (44%), Positives = 483/798 (60%), Gaps = 35/798 (4%)
 Frame = +1

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQNA--SQVSISISEH---SW- 88
           +G P  +T ++G    L C ++   E P++ W++DG +++ A  +Q  + + E     W 
Sbjct: 94  VGNPGNITGARGLTGTLRCELQVQGEPPEVMWLRDGQILELADNTQTQVPLGEDWQDEWK 273

Query: 89  -IGLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L + +++ SDAG Y C V     T +SQ  ++ +EG+P+F  EP+D AVP N PF 
Sbjct: 274 VVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFN 453

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPVT+ W +    L  V G +   S L   G+ + + FSCEA N KG+ TS
Sbjct: 454 LSCQAQGPPEPVTLLWLQDAVPLAPVAGYSFQHS-LQAPGLNKTSSFSCEAHNAKGVTTS 630

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVA---HAPGEW-- 259
           R A + +   P  P N  V +       VAW+P   G+  L  CT+Q        G W  
Sbjct: 631 RTATITVL--PQRPHNLHVVSRHPTELEVAWIPTLSGIYPLTHCTLQAVLSNDGVGVWLG 804

Query: 260 ------EALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPA 313
                 E L V V VPP    L  L P T Y +RV C ++ GPSP+  W+P +T    P 
Sbjct: 805 KSDPPEEPLTVQVSVPPHQLRLEKLLPHTPYHIRVSCTSSQGPSPWTHWLPVETTEGVPL 984

Query: 314 RAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT- 372
             P+N  A+R  S  ++ W+E  P +P +G L  Y+L++  ++ T + LM  G    +T 
Sbjct: 985 GPPENVSAMRNGSQALVRWQE--PREPLQGTLLGYRLAYRGQD-TPEVLMDIGLTREVTL 1155

Query: 373 ---DWDPQKDLILRVCASNAIGDGPWSQPLVVSS---------HDHAGRQGPPHSRTSWV 420
                 P  +L + V A  + GDGPWS P+ +           H       PP     W 
Sbjct: 1156ELRGDRPVANLTVSVAAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPPAFSWPWW 1335

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            V+LG                 +R+KETR+G+ F+  + RGE  V +RA +S++R   E 
Sbjct: 1336YVLLGALVAAACVLILTLFLVHRRKKETRYGEVFEPTVERGELVVRYRARKSYSRRTTE- 1512

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
             ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK
Sbjct: 1513--ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVK 1683

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGD
Sbjct: 1684TMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGD 1863

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LH+FLL SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VC
Sbjct: 1864LHSFLLYSRLGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVC 2043

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQ
Sbjct: 2044VADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQ 2223

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSF  LR +LEN L
Sbjct: 2224TPYPGVENSEIYDYLRQGNRLKQPLDCLDGLYALMSRCWELNPRDRPSFAELREDLENTL 2403

Query: 781 GHLSVLSTSQDPLYINIE 798
             L       + LY+N++
Sbjct: 2404KALPPAQEPDEILYVNMD 2457
>gb|M76125.1|HUMTYRKINR Human tyrosine kinase receptor (axl) mRNA, complete cds
          Length = 3227

 Score =  637 bits (1644), Expect = e-180
 Identities = 356/807 (44%), Positives = 486/807 (60%), Gaps = 32/807 (3%)
 Frame = +3

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQ--NASQVSISISEHS---WI 89
            +G P  +T ++G    L C ++   E P++HW++DG +++  +++Q  + + E     WI
Sbjct: 270  VGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWI 449

Query: 90   GLLSLK--SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
             +  L+  S++ SD G Y C V  G +T +SQ  ++ +EG+P+F  EP+D  V  N PF 
Sbjct: 450  VVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFN 629

Query: 148  LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
            LSC+A GPPEPV + W +    L    G  P  S L+V G+ + + FSCEA N KG+ TS
Sbjct: 630  LSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRS-LHVPGLNKTSSFSCEAHNAKGVTTS 806

Query: 205  RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHA--------- 255
            R A + +   P  P N  + +       VAW PG  G+  L  CT+Q   +         
Sbjct: 807  RTATITVL--PQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAG 980

Query: 256  ---PGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAP 312
               P E E L     VPP    L +L P T Y +RV C ++ GPS +  W+P +T    P
Sbjct: 981  EPDPPE-EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVP 1157

Query: 313  ARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT 372
               P+N  A R  S   + W+E  P  P +G L  Y+L++ Q   T + LM  G R  +T
Sbjct: 1158 LGPPKNISATRNGSQAFVHWQE--PRAPLQGTLLGYRLAY-QGQDTPEVLMDIGLRQEVT 1328

Query: 373  DWDPQKD-----LILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVX 427
              + Q D     L + V A  A GDGPWS P+ + +         P     W  V+LG  
Sbjct: 1329 -LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPVKEPSTPAFSWPWWYVLLGAV 1505

Query: 428  XXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDS 487
                           +R+KETR+G+ F+  + RGE  V +R  +S++R   E   ATL+S
Sbjct: 1506 VAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTE---ATLNS 1676

Query: 488  LGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADII 547
            LGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK +K  I 
Sbjct: 1677 LGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVKTMKIAIC 1853

Query: 548  ASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
              S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGDLH+FLL 
Sbjct: 1854 TRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLY 2033

Query: 608  SRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VCVADFGLS
Sbjct: 2034 SRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLS 2213

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            +KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQTPY G+E
Sbjct: 2214 KKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVE 2393

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
            N+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSFT LR +LEN L  L    
Sbjct: 2394 NSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQ 2573

Query: 788  TSQDPLYINIERA----EQPTESGSPE 810
               + LY+N++      E P  +G  +
Sbjct: 2574 EPDEILYVNMDEGGGYPEPPGAAGGAD 2654
>ref|NM_001699.2| Homo sapiens AXL receptor tyrosine kinase (AXL), transcript variant
            2, mRNA
          Length = 4986

 Score =  637 bits (1644), Expect = e-180
 Identities = 356/807 (44%), Positives = 486/807 (60%), Gaps = 32/807 (3%)
 Frame = +3

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQ--NASQVSISISEHS---WI 89
            +G P  +T ++G    L C ++   E P++HW++DG +++  +++Q  + + E     WI
Sbjct: 570  VGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWI 749

Query: 90   GLLSLK--SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
             +  L+  S++ SD G Y C V  G +T +SQ  ++ +EG+P+F  EP+D  V  N PF 
Sbjct: 750  VVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFN 929

Query: 148  LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
            LSC+A GPPEPV + W +    L    G  P  S L+V G+ + + FSCEA N KG+ TS
Sbjct: 930  LSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRS-LHVPGLNKTSSFSCEAHNAKGVTTS 1106

Query: 205  RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHA--------- 255
            R A + +   P  P N  + +       VAW PG  G+  L  CT+Q   +         
Sbjct: 1107 RTATITVL--PQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAG 1280

Query: 256  ---PGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAP 312
               P E E L     VPP    L +L P T Y +RV C ++ GPS +  W+P +T    P
Sbjct: 1281 EPDPPE-EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVP 1457

Query: 313  ARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT 372
               P+N  A R  S   + W+E  P  P +G L  Y+L++ Q   T + LM  G R  +T
Sbjct: 1458 LGPPKNISATRNGSQAFVHWQE--PRAPLQGTLLGYRLAY-QGQDTPEVLMDIGLRQEVT 1628

Query: 373  DWDPQKD-----LILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVX 427
              + Q D     L + V A  A GDGPWS P+ + +         P     W  V+LG  
Sbjct: 1629 -LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPVKEPSTPAFSWPWWYVLLGAV 1805

Query: 428  XXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDS 487
                           +R+KETR+G+ F+  + RGE  V +R  +S++R   E   ATL+S
Sbjct: 1806 VAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTE---ATLNS 1976

Query: 488  LGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADII 547
            LGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK +K  I 
Sbjct: 1977 LGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVKTMKIAIC 2153

Query: 548  ASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
              S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGDLH+FLL 
Sbjct: 2154 TRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLY 2333

Query: 608  SRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VCVADFGLS
Sbjct: 2334 SRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLS 2513

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            +KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQTPY G+E
Sbjct: 2514 KKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVE 2693

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
            N+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSFT LR +LEN L  L    
Sbjct: 2694 NSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQ 2873

Query: 788  TSQDPLYINIERA----EQPTESGSPE 810
               + LY+N++      E P  +G  +
Sbjct: 2874 EPDEILYVNMDEGGGYPEPPGAAGGAD 2954
>ref|XM_015505.1| Homo sapiens AXL receptor tyrosine kinase (AXL), mRNA
          Length = 5022

 Score =  634 bits (1636), Expect = e-179
 Identities = 357/816 (43%), Positives = 487/816 (58%), Gaps = 41/816 (5%)
 Frame = +2

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQ--NASQVSISISEHS---WI 89
            +G P  +T ++G    L C ++   E P++HW++DG +++  +++Q  + + E     WI
Sbjct: 587  VGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWI 766

Query: 90   GLLSLK--SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
             +  L+  S++ SD G Y C V  G +T +SQ  ++ +EG+P+F  EP+D  V  N PF 
Sbjct: 767  VVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFN 946

Query: 148  LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
            LSC+A GPPEPV + W +    L    G  P  S L+V G+ + + FSCEA N KG+ TS
Sbjct: 947  LSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRS-LHVPGLNKTSSFSCEAHNAKGVTTS 1123

Query: 205  RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHA--------- 255
            R A + +   P  P N  + +       VAW PG  G+  L  CT+Q   +         
Sbjct: 1124 RTATITVL--PQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSNDGMGIQAG 1297

Query: 256  ---PGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAP 312
               P E E L     VPP    L +L P T Y +RV C ++ GPS +  W+P +T    P
Sbjct: 1298 EPDPPE-EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVP 1474

Query: 313  ARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT 372
               P+N  A R  S   + W+E  P  P +G L  Y+L++ Q   T + LM  G R  +T
Sbjct: 1475 LGPPENISATRNGSQAFVHWQE--PRAPLQGTLLGYRLAY-QGQDTPEVLMDIGLRQEVT 1645

Query: 373  DWDPQKD-----LILRVCASNAIGDGPWSQPLVVSS---------HDHAGRQGPPHSRTS 418
              + Q D     L + V A  A GDGPWS P+ + +         H        P     
Sbjct: 1646 -LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWP 1822

Query: 419  WVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERP 478
            W  V+LG                 +R+KETR+G+ F+  + RGE  V +R  +S++R   
Sbjct: 1823 WWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTT 2002

Query: 479  ERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVA 538
            E   ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVA
Sbjct: 2003 E---ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVA 2170

Query: 539  VKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH 598
            VK +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKH
Sbjct: 2171 VKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKH 2350

Query: 599  GDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMT 658
            GDLH+FLL SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+
Sbjct: 2351 GDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMS 2530

Query: 659  VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTR 718
            VCVADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TR
Sbjct: 2531 VCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATR 2710

Query: 719  GQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELEN 778
            GQTPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSFT LR +LEN
Sbjct: 2711 GQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLEN 2890

Query: 779  ILGHLSVLSTSQDPLYINIERA----EQPTESGSPE 810
             L  L       + LY+N++      E P  +G  +
Sbjct: 2891 TLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGAD 2998
>emb|X57019.1|HSUF025 H.sapiens mRNA for tyrosine kinase receptor
          Length = 3116

 Score =  630 bits (1626), Expect = e-178
 Identities = 356/816 (43%), Positives = 485/816 (58%), Gaps = 41/816 (5%)
 Frame = +3

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQ--NASQVSISISEHS---WI 89
           +G P  +T ++G    L C ++   E P++HW++DG +++  +++Q  + + E     WI
Sbjct: 147 VGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWI 326

Query: 90  GLLSLK--SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L+  S++ SD G Y C V  G +T +SQ  ++ +EG+P+F  EP+D  V  N PF 
Sbjct: 327 VVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFN 506

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPV + W +    L    G  P  S L+V G+ + + FSCEA N KG+ TS
Sbjct: 507 LSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRS-LHVPGLNKTSSFSCEAHNAKGVTTS 683

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHA--------- 255
           R A + +   P  P N  + +       VAW PG  G+  L  CT+Q   +         
Sbjct: 684 RTATITVL--PQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAG 857

Query: 256 ---PGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAP 312
              P E E L     VPP    L +L P   Y +RV C ++ GPS +  W+P +T    P
Sbjct: 858 EPDPPE-EPLTSQASVPPHQLRLGSLHPHPPYHIRVACTSSQGPSSWTHWLPVETPEGVP 1034

Query: 313 ARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT 372
              P+N  A R  S   + W+E  P  P +G L  Y+L++ Q   T + LM  G R  +T
Sbjct: 1035LGPPENISATRNGSQAFVHWQE--PRAPLQGTLLGYRLAY-QGQDTPEVLMDIGLRQEVT 1205

Query: 373 DWDPQKD-----LILRVCASNAIGDGPWSQPLVVSS---------HDHAGRQGPPHSRTS 418
             + Q D     L + V A  A GDGPWS P+ + +         H        P     
Sbjct: 1206-LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGEAQPVHQLVKEPSTPAFSWP 1382

Query: 419 WVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERP 478
           W  V+LG                 +R+KETR+G+ F+  + RGE  V +R  +S++R   
Sbjct: 1383WWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTT 1562

Query: 479 ERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVA 538
           E   ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVA
Sbjct: 1563E---ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVA 1730

Query: 539 VKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH 598
           VK +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKH
Sbjct: 1731VKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKH 1910

Query: 599 GDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMT 658
           GDLH+FLL SR+G  P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+
Sbjct: 1911GDLHSFLLYSRLGGQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMS 2090

Query: 659 VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTR 718
           VCVADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TR
Sbjct: 2091VCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATR 2270

Query: 719 GQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELEN 778
           GQTPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSFT LR +LEN
Sbjct: 2271GQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLEN 2450

Query: 779 ILGHLSVLSTSQDPLYINIERA----EQPTESGSPE 810
            L  L       + LY+N++      E P  +G  +
Sbjct: 2451TLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGAD 2558
>gb|S65125.1|S65125 UFO=proto-oncogene [human, NIH3T3 cell, mRNA, 3116 nt]
          Length = 3116

 Score =  630 bits (1626), Expect = e-178
 Identities = 356/816 (43%), Positives = 485/816 (58%), Gaps = 41/816 (5%)
 Frame = +3

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQ--NASQVSISISEHS---WI 89
           +G P  +T ++G    L C ++   E P++HW++DG +++  +++Q  + + E     WI
Sbjct: 147 VGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWI 326

Query: 90  GLLSLK--SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L+  S++ SD G Y C V  G +T +SQ  ++ +EG+P+F  EP+D  V  N PF 
Sbjct: 327 VVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFN 506

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPV + W +    L    G  P  S L+V G+ + + FSCEA N KG+ TS
Sbjct: 507 LSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRS-LHVPGLNKTSSFSCEAHNAKGVTTS 683

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHA--------- 255
           R A + +   P  P N  + +       VAW PG  G+  L  CT+Q   +         
Sbjct: 684 RTATITVL--PQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAG 857

Query: 256 ---PGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAP 312
              P E E L     VPP    L +L P   Y +RV C ++ GPS +  W+P +T    P
Sbjct: 858 EPDPPE-EPLTSQASVPPHQLRLGSLHPHPPYHIRVACTSSQGPSSWTHWLPVETPEGVP 1034

Query: 313 ARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT 372
              P+N  A R  S   + W+E  P  P +G L  Y+L++ Q   T + LM  G R  +T
Sbjct: 1035LGPPENISATRNGSQAFVHWQE--PRAPLQGTLLGYRLAY-QGQDTPEVLMDIGLRQEVT 1205

Query: 373 DWDPQKD-----LILRVCASNAIGDGPWSQPLVVSS---------HDHAGRQGPPHSRTS 418
             + Q D     L + V A  A GDGPWS P+ + +         H        P     
Sbjct: 1206-LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGEAQPVHQLVKEPSTPAFSWP 1382

Query: 419 WVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERP 478
           W  V+LG                 +R+KETR+G+ F+  + RGE  V +R  +S++R   
Sbjct: 1383WWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTT 1562

Query: 479 ERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVA 538
           E   ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVA
Sbjct: 1563E---ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVA 1730

Query: 539 VKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH 598
           VK +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKH
Sbjct: 1731VKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKH 1910

Query: 599 GDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMT 658
           GDLH+FLL SR+G  P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+
Sbjct: 1911GDLHSFLLYSRLGGQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMS 2090

Query: 659 VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTR 718
           VCVADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TR
Sbjct: 2091VCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATR 2270

Query: 719 GQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELEN 778
           GQTPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSFT LR +LEN
Sbjct: 2271GQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLEN 2450

Query: 779 ILGHLSVLSTSQDPLYINIERA----EQPTESGSPE 810
            L  L       + LY+N++      E P  +G  +
Sbjct: 2451TLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGAD 2558
>ref|NM_021913.1| Homo sapiens AXL receptor tyrosine kinase (AXL), transcript variant
            1, mRNA
          Length = 5015

 Score =  630 bits (1626), Expect = e-178
 Identities = 356/816 (43%), Positives = 485/816 (58%), Gaps = 41/816 (5%)
 Frame = +2

Query: 36   MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQ--NASQVSISISEHS---WI 89
            +G P  +T ++G    L C ++   E P++HW++DG +++  +++Q  + + E     WI
Sbjct: 572  VGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWI 751

Query: 90   GLLSLK--SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
             +  L+  S++ SD G Y C V  G +T +SQ  ++ +EG+P+F  EP+D  V  N PF 
Sbjct: 752  VVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFN 931

Query: 148  LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
            LSC+A GPPEPV + W +    L    G  P  S L+V G+ + + FSCEA N KG+ TS
Sbjct: 932  LSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRS-LHVPGLNKTSSFSCEAHNAKGVTTS 1108

Query: 205  RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHA--------- 255
            R A + +   P  P N  + +       VAW PG  G+  L  CT+Q   +         
Sbjct: 1109 RTATITVL--PQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAG 1282

Query: 256  ---PGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAP 312
               P E E L     VPP    L +L P   Y +RV C ++ GPS +  W+P +T    P
Sbjct: 1283 EPDPPE-EPLTSQASVPPHQLRLGSLHPHPPYHIRVACTSSQGPSSWTHWLPVETPEGVP 1459

Query: 313  ARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT 372
               P+N  A R  S   + W+E  P  P +G L  Y+L++ Q   T + LM  G R  +T
Sbjct: 1460 LGPPENISATRNGSQAFVHWQE--PRAPLQGTLLGYRLAY-QGQDTPEVLMDIGLRQEVT 1630

Query: 373  DWDPQKD-----LILRVCASNAIGDGPWSQPLVVSS---------HDHAGRQGPPHSRTS 418
              + Q D     L + V A  A GDGPWS P+ + +         H        P     
Sbjct: 1631 -LELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGEAQPVHQLVKEPSTPAFSWP 1807

Query: 419  WVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERP 478
            W  V+LG                 +R+KETR+G+ F+  + RGE  V +R  +S++R   
Sbjct: 1808 WWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTT 1987

Query: 479  ERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVA 538
            E   ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVA
Sbjct: 1988 E---ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVA 2155

Query: 539  VKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH 598
            VK +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKH
Sbjct: 2156 VKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKH 2335

Query: 599  GDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMT 658
            GDLH+FLL SR+G  P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+
Sbjct: 2336 GDLHSFLLYSRLGGQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMS 2515

Query: 659  VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTR 718
            VCVADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TR
Sbjct: 2516 VCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATR 2695

Query: 719  GQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELEN 778
            GQTPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSFT LR +LEN
Sbjct: 2696 GQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELREDLEN 2875

Query: 779  ILGHLSVLSTSQDPLYINIERA----EQPTESGSPE 810
             L  L       + LY+N++      E P  +G  +
Sbjct: 2876 TLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGAD 2983
>emb|X59560.1|MMTYRKR M.musculus gene for tyrosine kinase receptor
          Length = 4126

 Score =  627 bits (1618), Expect = e-177
 Identities = 348/798 (43%), Positives = 486/798 (60%), Gaps = 35/798 (4%)
 Frame = +3

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQNA--SQVSISISEH---SW- 88
           +G P  +T ++G    L C ++   E P++ W++DG +++ A  +Q  + + E     W 
Sbjct: 153 VGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWK 332

Query: 89  -IGLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L + +++ SDAG Y C V     T +SQ  ++ +EG+P+F  EP+D AVP N PF 
Sbjct: 333 VVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFN 512

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPVT+ W +    L  V G +   S L   G+ + + FSCEA N KG+ TS
Sbjct: 513 LSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHS-LQTPGLNKTSSFSCEAHNAKGVTTS 689

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP---GEW-- 259
           R A + +   P  P +  V +       VAW PG  G+  L  C +Q   +    G W  
Sbjct: 690 RTATITVL--PQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLG 863

Query: 260 ------EALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPA 313
                 + L + V VPP    L  L P T Y +R+ C+++ GPSP+  W+P +T    P 
Sbjct: 864 KSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPL 1043

Query: 314 RAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT- 372
             P+N  A+R  S +++ W+E  P  P +G L  Y+L++  ++ T + LM  G    +T 
Sbjct: 1044GPPENVSAMRNGSQVLVRWQE--PRVPLQGTLLGYRLAYRGQD-TPEVLMDIGLTREVTL 1214

Query: 373 ---DWDPQKDLILRVCASNAIGDGPWSQPLVVSSH--------DHAGRQGPPHSRT-SWV 420
                 P ++L + V A  + GDGPWS P+ +            H   + PP + +  W 
Sbjct: 1215ELRGDRPVRNLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWW 1394

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            V+LG                 +R+KETR+G+ F+  + R E  V +R  +S++R   E 
Sbjct: 1395YVLLGALVAAACVLILALFLVHRRKKETRYGEVFEPTVERPELVVRYRVRKSYSRRTTE- 1571

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
             ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK
Sbjct: 1572--ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVK 1742

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGD
Sbjct: 1743TMKIVICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGD 1922

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LH+FLL SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VC
Sbjct: 1923LHSFLLYSRLGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVC 2102

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQ
Sbjct: 2103VADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQ 2282

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSF  LR +LEN L
Sbjct: 2283TPYPGVENSEIYDYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTL 2462

Query: 781 GHLSVLSTSQDPLYINIE 798
             L       + LY+N++
Sbjct: 2463KALPPAQEPDEILYVNMD 2516
>ref|NM_009465.1| Mus musculus AXL receptor tyrosine kinase (Axl), mRNA
          Length = 2667

 Score =  627 bits (1618), Expect = e-177
 Identities = 348/798 (43%), Positives = 486/798 (60%), Gaps = 35/798 (4%)
 Frame = +1

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQNA--SQVSISISEH---SW- 88
           +G P  +T ++G    L C ++   E P++ W++DG +++ A  +Q  + + E     W 
Sbjct: 94  VGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWK 273

Query: 89  -IGLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L + +++ SDAG Y C V     T +SQ  ++ +EG+P+F  EP+D AVP N PF 
Sbjct: 274 VVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFN 453

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPVT+ W +    L  V G +   S L   G+ + + FSCEA N KG+ TS
Sbjct: 454 LSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHS-LQTPGLNKTSSFSCEAHNAKGVTTS 630

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP---GEW-- 259
           R A + +   P  P +  V +       VAW PG  G+  L  C +Q   +    G W  
Sbjct: 631 RTATITVL--PQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLG 804

Query: 260 ------EALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPA 313
                 + L + V VPP    L  L P T Y +R+ C+++ GPSP+  W+P +T    P 
Sbjct: 805 KSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPL 984

Query: 314 RAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT- 372
             P+N  A+R  S +++ W+E  P  P +G L  Y+L++  ++ T + LM  G    +T 
Sbjct: 985 GPPENVSAMRNGSQVLVRWQE--PRVPLQGTLLGYRLAYRGQD-TPEVLMDIGLTREVTL 1155

Query: 373 ---DWDPQKDLILRVCASNAIGDGPWSQPLVVSSH--------DHAGRQGPPHSRT-SWV 420
                 P ++L + V A  + GDGPWS P+ +            H   + PP + +  W 
Sbjct: 1156ELRGDRPVRNLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWW 1335

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            V+LG                 +R+KETR+G+ F+  + R E  V +R  +S++R   E 
Sbjct: 1336YVLLGALVAAACVLILALFLVHRRKKETRYGEVFEPTVERPELVVRYRVRKSYSRRTTE- 1512

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
             ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK
Sbjct: 1513--ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVK 1683

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGD
Sbjct: 1684TMKIVICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGD 1863

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LH+FLL SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VC
Sbjct: 1864LHSFLLYSRLGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVC 2043

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQ
Sbjct: 2044VADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQ 2223

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPY G+EN+EIY+YL  GNRLKQP +C++ +Y LM +CW  +P+ RPSF  LR +LEN L
Sbjct: 2224TPYPGVENSEIYDYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTL 2403

Query: 781 GHLSVLSTSQDPLYINIE 798
             L       + LY+N++
Sbjct: 2404KALPPAQEPDEILYVNMD 2457
>emb|X63535.1|MMUFO M.musculus ufo mRNA
          Length = 4072

 Score =  626 bits (1615), Expect = e-177
 Identities = 348/798 (43%), Positives = 485/798 (60%), Gaps = 35/798 (4%)
 Frame = +2

Query: 36  MGAPVKMTVSQGQPVKLNCSVEGM-EDPDIHWMKDGTVVQNA--SQVSISISEH---SW- 88
           +G P  +T ++G    L C ++   E P++ W++DG +++ A  +Q  + + E     W 
Sbjct: 98  VGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWK 277

Query: 89  -IGLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQ 147
            +  L + +++ SDAG Y C V     T +SQ  ++ +EG+P+F  EP+D AVP N PF 
Sbjct: 278 VVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFN 457

Query: 148 LSCEAVGPPEPVTIYWWRG---LTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATS 204
           LSC+A GPPEPVT+ W +    L  V G +   S L   G+ + + FSCEA N KG+ TS
Sbjct: 458 LSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHS-LQTPGLNKTSSFSCEAHNAKGVTTS 634

Query: 205 RPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP---GEW-- 259
           R A + +   P  P +  V +       VAW PG  G+  L  C +Q   +    G W  
Sbjct: 635 RTATITVL--PQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLG 808

Query: 260 ------EALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPA 313
                 + L + V VPP    L  L P T Y +R+ C+++ GPSP+  W+P +T    P 
Sbjct: 809 KSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPL 988

Query: 314 RAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLT- 372
             P+N  A+R  S +++ W+E  P  P +G L  Y+L++  ++ T + LM  G    +T 
Sbjct: 989 GPPENVSAMRNGSQVLVRWQE--PRVPLQGTLLGYRLAYRGQD-TPEVLMDIGLTREVTL 1159

Query: 373 ---DWDPQKDLILRVCASNAIGDGPWSQPLVVSSH--------DHAGRQGPPHSRT-SWV 420
                 P  +L + V A  + GDGPWS P+ +            H   + PP + +  W 
Sbjct: 1160ELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWW 1339

Query: 421 PVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER 480
            V+LG                 +R+KETR+G+ F+  + RGE  V +R  +S++R   E 
Sbjct: 1340YVLLGALVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTE- 1516

Query: 481 IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK 540
             ATL+SLGIS+ELKEKL DV++   +  LG+ LG+GEFG+V E QL Q+D S +KVAVK
Sbjct: 1517--ATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDD-SILKVAVK 1687

Query: 541 MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD 600
            +K  I   S++E+FL EA CMKEFDHP+V +L+GV  +   +   P P+VILPFMKHGD
Sbjct: 1688TMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGD 1867

Query: 601 LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
           LH+FLL SR+G+ P  LP Q LV+FM DIA GMEYLS++ FIHRDLAARNCML E+M+VC
Sbjct: 1868LHSFLLYSRLGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVC 2047

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           VADFGLS+KIY+GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVW+FGVTMWEI TRGQ
Sbjct: 2048VADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQ 2227

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           TPY G+EN+EIY+YL  GNRLKQP + ++ +Y LM +CW  +P+ RPSF  LR +LEN L
Sbjct: 2228TPYPGVENSEIYDYLRQGNRLKQPVDFLDGLYSLMSRCWELNPRDRPSFAELREDLENTL 2407

Query: 781 GHLSVLSTSQDPLYINIE 798
             L       + LY+N++
Sbjct: 2408KALPPAQEPDEILYVNMD 2461
>ref|NM_022943.1| Rattus norvegicus MERTK (Mertk), mRNA
          Length = 3024

 Score =  614 bits (1583), Expect = e-173
 Identities = 347/789 (43%), Positives = 480/789 (59%), Gaps = 28/789 (3%)
 Frame = +1

Query: 41   KMTVSQGQPVKLNCSVE----GMEDPDIHWMKDGTVVQNASQVSISISEH-------SWI 89
            ++ +S+ + VK NCS+       E   I W KDG  +  A     SI++        S I
Sbjct: 325  RIVLSEHKSVKFNCSINIPNVYQETAGISWWKDGKELLGAHH---SITQFYPDEEGVSII 495

Query: 90   GLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLS 149
             L S+ SV+RSD G Y C++K  +   +S  +++ V+G+P+FT +P+ + V  N  F L+
Sbjct: 496  ALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLT 675

Query: 150  CEAVGPPEPVTIYWWRGLTKVG-GPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAI 208
            C+AVGPPEPV I+W +  ++V   P  SPSVL V G+T+   FSCEA N KGL  S+   
Sbjct: 676  CQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFSCEAHNDKGLTVSKGVQ 855

Query: 209  VRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP--GEWEALAVVV 266
            + ++  P+ P    +   ++++  V+WVPG DG + L +C++QV  A        +    
Sbjct: 856  INIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADQLSNGSVMVFNT 1035

Query: 267  PVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDS 326
               P    ++ L    NYS+ V C N +G S    W+   T   APA AP N      +S
Sbjct: 1036 SASPHLYEVQQLQALANYSVTVSCRNEIGWSAVSPWILASTTEGAPAVAPLNITVFLNES 1215

Query: 327  GLILE--WEEVIPEDPGEGPLGPYKLSWVQEN-GTQDELMVE----GTRANLTDWDPQKD 379
               LE  W +  P    +G L  Y++S V E+ GT  EL  E    G+ A +        
Sbjct: 1216 SNNLEIRWTKP-PIKRQDGELVGYRISHVWESAGTSKELSEEVSQNGSWAQVPVQMHNAT 1392

Query: 380  LILRVCASNAIGDGPWSQPLVV-----SSHDHAGRQGPPHSRTSWVPVVLGVX--XXXXX 432
              +R+      G GP+S+P+ V     S  D+A    P    T  + ++LG         
Sbjct: 1393 CTVRIAVITKGGIGPFSEPVDVAIPEHSRVDYAPSSTPAPGNTESMLIILGCFCGFVLMG 1572

Query: 433  XXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISD 492
                     ++R +ET+FG AF       +  V++RA +SF R     IE TL SLG+S+
Sbjct: 1573 LILYLSLAIKRRVQETKFGGAFSE--EDSQLVVNYRAKKSFCRRA---IELTLQSLGVSE 1737

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
            EL+ KLEDV++      LG++LG+GEFGSV E  LKQEDG+  KVAVK +K D  +  +I
Sbjct: 1738 ELQNKLEDVVVDRNLLILGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSLREI 1917

Query: 553  EEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGE 612
            EEFL EAACMK+F+HP+V +L+GV +   ++G +P PMVILPFMK+GDLH FLL SRI  
Sbjct: 1918 EEFLSEAACMKDFNHPNVIRLLGVCIELSSQG-IPKPMVILPFMKYGDLHTFLLYSRIES 2094

Query: 613  NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYS 672
             P ++PLQTL++FMVDIA GMEYLSSRNF+HRDLAARNCML +DMTVCVADFGLS+KIYS
Sbjct: 2095 VPKSIPLQTLLKFMVDIAQGMEYLSSRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYS 2274

Query: 673  GDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIY 732
            GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y
Sbjct: 2275 GDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMY 2454

Query: 733  NYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDP 792
            +YL+ G+RLKQP +C++++Y++MY CWSADP  RP+F+ LR++LE +   L      +  
Sbjct: 2455 DYLLHGHRLKQPEDCLDDLYEIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESI 2634

Query: 793  LYINIERAE 801
            +YIN +  E
Sbjct: 2635 IYINTQLLE 2661
>gb|AF208235.1|AF208235 Rattus norvegicus MERTK (Mertk) mRNA, complete cds
          Length = 3024

 Score =  614 bits (1583), Expect = e-173
 Identities = 347/789 (43%), Positives = 480/789 (59%), Gaps = 28/789 (3%)
 Frame = +1

Query: 41   KMTVSQGQPVKLNCSVE----GMEDPDIHWMKDGTVVQNASQVSISISEH-------SWI 89
            ++ +S+ + VK NCS+       E   I W KDG  +  A     SI++        S I
Sbjct: 325  RIVLSEHKSVKFNCSINIPNVYQETAGISWWKDGKELLGAHH---SITQFYPDEEGVSII 495

Query: 90   GLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLS 149
             L S+ SV+RSD G Y C++K  +   +S  +++ V+G+P+FT +P+ + V  N  F L+
Sbjct: 496  ALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLT 675

Query: 150  CEAVGPPEPVTIYWWRGLTKVG-GPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAI 208
            C+AVGPPEPV I+W +  ++V   P  SPSVL V G+T+   FSCEA N KGL  S+   
Sbjct: 676  CQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFSCEAHNDKGLTVSKGVQ 855

Query: 209  VRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP--GEWEALAVVV 266
            + ++  P+ P    +   ++++  V+WVPG DG + L +C++QV  A        +    
Sbjct: 856  INIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADQLSNGSVMVFNT 1035

Query: 267  PVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDS 326
               P    ++ L    NYS+ V C N +G S    W+   T   APA AP N      +S
Sbjct: 1036 SASPHLYEVQQLQALANYSVTVSCRNEIGWSAVSPWILASTTEGAPAVAPLNITVFLNES 1215

Query: 327  GLILE--WEEVIPEDPGEGPLGPYKLSWVQEN-GTQDELMVE----GTRANLTDWDPQKD 379
               LE  W +  P    +G L  Y++S V E+ GT  EL  E    G+ A +        
Sbjct: 1216 SNNLEIRWTKP-PIKRQDGELVGYRISHVWESAGTSKELSEEVSQNGSWAQVPVQMHNAT 1392

Query: 380  LILRVCASNAIGDGPWSQPLVV-----SSHDHAGRQGPPHSRTSWVPVVLGVX--XXXXX 432
              +R+      G GP+S+P+ V     S  D+A    P    T  + ++LG         
Sbjct: 1393 CTVRIAVITKGGIGPFSEPVDVAIPEHSRVDYAPSSTPAPGNTESMLIILGCFCGFVLMG 1572

Query: 433  XXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISD 492
                     ++R +ET+FG AF       +  V++RA +SF R     IE TL SLG+S+
Sbjct: 1573 LILYLSLAIKRRVQETKFGGAFSE--EDSQLVVNYRAKKSFCRRA---IELTLQSLGVSE 1737

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
            EL+ KLEDV++      LG++LG+GEFGSV E  LKQEDG+  KVAVK +K D  +  +I
Sbjct: 1738 ELQNKLEDVVVDRNLLILGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSLREI 1917

Query: 553  EEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGE 612
            EEFL EAACMK+F+HP+V +L+GV +   ++G +P PMVILPFMK+GDLH FLL SRI  
Sbjct: 1918 EEFLSEAACMKDFNHPNVIRLLGVCIELSSQG-IPKPMVILPFMKYGDLHTFLLYSRIES 2094

Query: 613  NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYS 672
             P ++PLQTL++FMVDIA GMEYLSSRNF+HRDLAARNCML +DMTVCVADFGLS+KIYS
Sbjct: 2095 VPKSIPLQTLLKFMVDIAQGMEYLSSRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYS 2274

Query: 673  GDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIY 732
            GDYYRQG  +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y
Sbjct: 2275 GDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMY 2454

Query: 733  NYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDP 792
            +YL+ G+RLKQP +C++++Y++MY CWSADP  RP+F+ LR++LE +   L      +  
Sbjct: 2455 DYLLHGHRLKQPEDCLDDLYEIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESI 2634

Query: 793  LYINIERAE 801
            +YIN +  E
Sbjct: 2635 IYINTQLLE 2661
>ref|NM_008587.1| Mus musculus c-mer proto-oncogene (Mer), mRNA
          Length = 3564

 Score =  612 bits (1577), Expect = e-173
 Identities = 345/788 (43%), Positives = 479/788 (60%), Gaps = 28/788 (3%)
 Frame = +2

Query: 42   MTVSQGQPVKLNCSVE----GMEDPDIHWMKDGTVVQNASQVSISISEH-------SWIG 90
            + +S+ + VK NCS+       E   I W KDG  +  A     SI++        S I 
Sbjct: 338  IVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHH---SITQFYPDEEGVSIIA 508

Query: 91   LLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSC 150
            L S+ SV+RSD G Y+C++K      +S  +++ V+G+P+F  +P+ + V  N  F L+C
Sbjct: 509  LFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTC 688

Query: 151  EAVGPPEPVTIYWWRGLTKVGG-PAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIV 209
            +AVGPPEPV I+W +  ++V   P  SPSVL V G+T+   FSCEA N KGL  S+   +
Sbjct: 689  QAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHI 868

Query: 210  RLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP--GEWEALAVVVP 267
             ++  P+ P    +   ++++  V+WVPG DG + L +C++QV  A        +     
Sbjct: 869  NIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTS 1048

Query: 268  VPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG 327
              P    ++ L    NYS+ V C N +G S    W+   T   AP+ AP N      +S 
Sbjct: 1049 ASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESN 1228

Query: 328  LILE--WEEVIPEDPGEGPLGPYKLSWVQEN-GTQDELMVE----GTRANLTDWDPQKDL 380
             IL+  W +  P    +G L  Y++S V E+ GT  EL  E    G+ A +         
Sbjct: 1229 NILDIRWTKP-PIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATC 1405

Query: 381  ILRVCASNAIGDGPWSQP--LVVSSH---DHAGRQGPPHSRTSWVPVVLGVXXXXXXXXX 435
             +R+ A    G GP+S+P  +++  H   D+A    P    T  + ++LG          
Sbjct: 1406 TVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMFIILGCFCGFILIGL 1585

Query: 436  XX--XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDE 493
                    R+R +ET+FG AF       +  V++RA +SF R     IE TL SLG+S+E
Sbjct: 1586 ILCISLALRRRVQETKFGGAFSE--EDSQLVVNYRAKKSFCRRA---IELTLQSLGVSEE 1750

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIE 553
            L+ KLEDV+I      LG++LG+GEFGSV E  LKQEDG+  KVAVK +K D  +  +IE
Sbjct: 1751 LQNKLEDVVIDRNLLVLGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIE 1930

Query: 554  EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN 613
            EFL EAACMK+F+HP+V +L+GV +   ++G +P PMVILPFMK+GDLH FLL SR+   
Sbjct: 1931 EFLSEAACMKDFNHPNVIRLLGVCIELSSQG-IPKPMVILPFMKYGDLHTFLLYSRLNTG 2107

Query: 614  PFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSG 673
            P  + LQTL++FM+DIA GMEYLS+RNF+HRDLAARNCML +DMTVCVADFGLS+KIYSG
Sbjct: 2108 PKYIHLQTLLKFMMDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSG 2287

Query: 674  DYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYN 733
            DYYRQG  +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y+
Sbjct: 2288 DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEITTRGMTPYPGVQNHEMYD 2467

Query: 734  YLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPL 793
            YL+ G+RLKQP +C++E+YD+MY CWSADP  RP+F+ LR++LE +   L      +  +
Sbjct: 2468 YLLHGHRLKQPEDCLDELYDIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESII 2647

Query: 794  YINIERAE 801
            YIN +  E
Sbjct: 2648 YINTQLLE 2671
>gb|U21301.1|MMU21301 Mus musculus c-mer tyrosine kinase receptor mRNA, complete cds
          Length = 3564

 Score =  612 bits (1577), Expect = e-173
 Identities = 345/788 (43%), Positives = 479/788 (60%), Gaps = 28/788 (3%)
 Frame = +2

Query: 42   MTVSQGQPVKLNCSVE----GMEDPDIHWMKDGTVVQNASQVSISISEH-------SWIG 90
            + +S+ + VK NCS+       E   I W KDG  +  A     SI++        S I 
Sbjct: 338  IVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHH---SITQFYPDEEGVSIIA 508

Query: 91   LLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSC 150
            L S+ SV+RSD G Y+C++K      +S  +++ V+G+P+F  +P+ + V  N  F L+C
Sbjct: 509  LFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTC 688

Query: 151  EAVGPPEPVTIYWWRGLTKVGG-PAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIV 209
            +AVGPPEPV I+W +  ++V   P  SPSVL V G+T+   FSCEA N KGL  S+   +
Sbjct: 689  QAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHI 868

Query: 210  RLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP--GEWEALAVVVP 267
             ++  P+ P    +   ++++  V+WVPG DG + L +C++QV  A        +     
Sbjct: 869  NIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTS 1048

Query: 268  VPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG 327
              P    ++ L    NYS+ V C N +G S    W+   T   AP+ AP N      +S 
Sbjct: 1049 ASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESN 1228

Query: 328  LILE--WEEVIPEDPGEGPLGPYKLSWVQEN-GTQDELMVE----GTRANLTDWDPQKDL 380
             IL+  W +  P    +G L  Y++S V E+ GT  EL  E    G+ A +         
Sbjct: 1229 NILDIRWTKP-PIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATC 1405

Query: 381  ILRVCASNAIGDGPWSQP--LVVSSH---DHAGRQGPPHSRTSWVPVVLGVXXXXXXXXX 435
             +R+ A    G GP+S+P  +++  H   D+A    P    T  + ++LG          
Sbjct: 1406 TVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMFIILGCFCGFILIGL 1585

Query: 436  XX--XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDE 493
                    R+R +ET+FG AF       +  V++RA +SF R     IE TL SLG+S+E
Sbjct: 1586 ILCISLALRRRVQETKFGGAFSE--EDSQLVVNYRAKKSFCRRA---IELTLQSLGVSEE 1750

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIE 553
            L+ KLEDV+I      LG++LG+GEFGSV E  LKQEDG+  KVAVK +K D  +  +IE
Sbjct: 1751 LQNKLEDVVIDRNLLVLGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIE 1930

Query: 554  EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN 613
            EFL EAACMK+F+HP+V +L+GV +   ++G +P PMVILPFMK+GDLH FLL SR+   
Sbjct: 1931 EFLSEAACMKDFNHPNVIRLLGVCIELSSQG-IPKPMVILPFMKYGDLHTFLLYSRLNTG 2107

Query: 614  PFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSG 673
            P  + LQTL++FM+DIA GMEYLS+RNF+HRDLAARNCML +DMTVCVADFGLS+KIYSG
Sbjct: 2108 PKYIHLQTLLKFMMDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSG 2287

Query: 674  DYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYN 733
            DYYRQG  +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y+
Sbjct: 2288 DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEITTRGMTPYPGVQNHEMYD 2467

Query: 734  YLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPL 793
            YL+ G+RLKQP +C++E+YD+MY CWSADP  RP+F+ LR++LE +   L      +  +
Sbjct: 2468 YLLHGHRLKQPEDCLDELYDIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESII 2647

Query: 794  YINIERAE 801
            YIN +  E
Sbjct: 2648 YINTQLLE 2671
>ref|NM_006343.1| Homo sapiens c-mer proto-oncogene tyrosine kinase (MERTK), mRNA
          Length = 3608

 Score =  610 bits (1574), Expect = e-172
 Identities = 339/782 (43%), Positives = 474/782 (60%), Gaps = 24/782 (3%)
 Frame = +3

Query: 44   VSQGQPVKLNCSVEG---MEDPDIHWMKDGTVV----QNASQVSISISEHSWIGLLSLKS 96
            +S+ + VK NCS+      +D  I W KDG  +       +Q        + I   S+ S
Sbjct: 450  LSEHKGVKFNCSINVPNIYQDTTISWWKDGKELLGGHHRITQFYPDDEVTAIIASFSITS 629

Query: 97   VERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPP 156
            V+RSD G Y C++K   E  +S  +++ V+G+P FT +P+ + V  N  F L+C+AVGPP
Sbjct: 630  VQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPP 809

Query: 157  EPVTIYWWRGLTKVGG-PAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            EPV I+W +  ++V   P  SP VL V G+T+   FSCEA N KGL  S+   + ++A P
Sbjct: 810  EPVNIFWVQNSSRVNEQPEKSPGVLTVPGLTEMAVFSCEAHNDKGLTVSQGVQINIKAIP 989

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP--GEWEALAVVVPVPPFTC 273
            + P   ++   ++++  ++WVPG DG +   +C++QV  A   G    +       P   
Sbjct: 990  SPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLGNGSVMIFNTSALPHLY 1169

Query: 274  LLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG--LILE 331
             ++ L    NYS+ V C N +G S    W+   T   AP+ AP N      +S   + + 
Sbjct: 1170 QIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIR 1349

Query: 332  WEEVIPEDPGEGPLGPYKLSWV-QENGTQDELMVE----GTRANLTDWDPQKDLILRVCA 386
            W +  P    +G L  Y++S V Q  G   EL+ E    G+RA ++         +R+ A
Sbjct: 1350 WMKP-PTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAA 1526

Query: 387  SNAIGDGPWSQP--LVVSSH---DHAGRQGPPHSRTSWVPVVLGVX--XXXXXXXXXXXX 439
                G GP+S P  + + +H   D+A    P       V ++ G                
Sbjct: 1527 VTRGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISL 1706

Query: 440  XXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLE 499
              RKR +ET+FG AF       E  V++ A +SF R     IE TL SLG+S+EL+ KLE
Sbjct: 1707 AIRKRVQETKFGNAFTE--EDSELVVNYIAKKSFCRRA---IELTLHSLGVSEELQNKLE 1871

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            DV+I      LG++LG+GEFGSV E  LKQEDG+ +KVAVK +K D  +  +IEEFL EA
Sbjct: 1872 DVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSHREIEEFLSEA 2051

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
            ACMK+F HP+V +L+GV +   ++G +P PMVILPFMK+GDLH +LL SR+   P ++PL
Sbjct: 2052 ACMKDFSHPNVIRLLGVCIEMSSQG-IPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPL 2228

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
            QTL++FMVDIA GMEYLS+RNF+HRDLAARNCML +DMTVCVADFGLS+KIYSGDYYRQG
Sbjct: 2229 QTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQG 2408

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
              +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y+YL+ G+
Sbjct: 2409 RIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIRTRGMTPYPGVQNHEMYDYLLHGH 2588

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIER 799
            RLKQP +C++E+Y++MY CW  DP  RP+F+ LR++LE +L  L  +    D +Y+N + 
Sbjct: 2589 RLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQL 2768

Query: 800  AE 801
             E
Sbjct: 2769 LE 2774
>gb|U08023.1|HSU08023 Human cellular proto-oncogene (c-mer) mRNA, complete cds
          Length = 3608

 Score =  610 bits (1574), Expect = e-172
 Identities = 339/782 (43%), Positives = 474/782 (60%), Gaps = 24/782 (3%)
 Frame = +3

Query: 44   VSQGQPVKLNCSVEG---MEDPDIHWMKDGTVV----QNASQVSISISEHSWIGLLSLKS 96
            +S+ + VK NCS+      +D  I W KDG  +       +Q        + I   S+ S
Sbjct: 450  LSEHKGVKFNCSINVPNIYQDTTISWWKDGKELLGGHHRITQFYPDDEVTAIIASFSITS 629

Query: 97   VERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPP 156
            V+RSD G Y C++K   E  +S  +++ V+G+P FT +P+ + V  N  F L+C+AVGPP
Sbjct: 630  VQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPP 809

Query: 157  EPVTIYWWRGLTKVGG-PAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPP 215
            EPV I+W +  ++V   P  SP VL V G+T+   FSCEA N KGL  S+   + ++A P
Sbjct: 810  EPVNIFWVQNSSRVNEQPEKSPGVLTVPGLTEMAVFSCEAHNDKGLTVSQGVQINIKAIP 989

Query: 216  AAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAP--GEWEALAVVVPVPPFTC 273
            + P   ++   ++++  ++WVPG DG +   +C++QV  A   G    +       P   
Sbjct: 990  SPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLGNGSVMIFNTSALPHLY 1169

Query: 274  LLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG--LILE 331
             ++ L    NYS+ V C N +G S    W+   T   AP+ AP N      +S   + + 
Sbjct: 1170 QIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIR 1349

Query: 332  WEEVIPEDPGEGPLGPYKLSWV-QENGTQDELMVE----GTRANLTDWDPQKDLILRVCA 386
            W +  P    +G L  Y++S V Q  G   EL+ E    G+RA ++         +R+ A
Sbjct: 1350 WMKP-PTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAA 1526

Query: 387  SNAIGDGPWSQP--LVVSSH---DHAGRQGPPHSRTSWVPVVLGVX--XXXXXXXXXXXX 439
                G GP+S P  + + +H   D+A    P       V ++ G                
Sbjct: 1527 VTRGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISL 1706

Query: 440  XXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLE 499
              RKR +ET+FG AF       E  V++ A +SF R     IE TL SLG+S+EL+ KLE
Sbjct: 1707 AIRKRVQETKFGNAFTE--EDSELVVNYIAKKSFCRRA---IELTLHSLGVSEELQNKLE 1871

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            DV+I      LG++LG+GEFGSV E  LKQEDG+ +KVAVK +K D  +  +IEEFL EA
Sbjct: 1872 DVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSHREIEEFLSEA 2051

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
            ACMK+F HP+V +L+GV +   ++G +P PMVILPFMK+GDLH +LL SR+   P ++PL
Sbjct: 2052 ACMKDFSHPNVIRLLGVCIEMSSQG-IPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPL 2228

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
            QTL++FMVDIA GMEYLS+RNF+HRDLAARNCML +DMTVCVADFGLS+KIYSGDYYRQG
Sbjct: 2229 QTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQG 2408

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
              +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y+YL+ G+
Sbjct: 2409 RIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIRTRGMTPYPGVQNHEMYDYLLHGH 2588

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIER 799
            RLKQP +C++E+Y++MY CW  DP  RP+F+ LR++LE +L  L  +    D +Y+N + 
Sbjct: 2589 RLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQL 2768

Query: 800  AE 801
             E
Sbjct: 2769 LE 2774
>gb|L21719.1|CHKCEYKONC Chicken c-eyk proto-oncogene mRNA, complete cds
          Length = 3037

 Score =  575 bits (1483), Expect = e-162
 Identities = 332/795 (41%), Positives = 460/795 (57%), Gaps = 30/795 (3%)
 Frame = +2

Query: 42   MTVSQGQPVKLNCSVE------GMEDPDIHWMKDGTVVQNASQVSISI------SEHSWI 89
            + +++ + V  NCS++        + P I   KDG  +    +++ S        E +  
Sbjct: 287  VVINELKDVTFNCSIKVPQLLVRPDSPGISLWKDGRELHTLDRIATSHFEILDEEEVAMT 466

Query: 90   GLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLS 149
               S+++ +RSD G Y C++        S  + + +EG+P F  +P+ L V  N+PF L+
Sbjct: 467  STFSIRAAQRSDNGSYVCKLNISGIEIASDPILVQLEGLPHFIQQPEKLNVTRNSPFNLT 646

Query: 150  CEAVGPPEPVTIYWWRGLTKVG-GPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAI 208
            C+AVGPPEPV IYW+R   ++   P  SPSVL V G+ +   FSCEA N KGL  S P  
Sbjct: 647  CQAVGPPEPVEIYWFRNNVQLNMKPYISPSVLTVPGLNETALFSCEAHNSKGLTASNPGQ 826

Query: 209  VRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVV--V 266
            V ++  P+AP    V    +++  ++WVPG D  + L+SC+VQV  A  +     ++   
Sbjct: 827  VNVKGIPSAPKAVHVLKRMAHSIVISWVPGFDAFSALNSCSVQVKEAVPQSNVSLLLFNT 1006

Query: 267  PVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDS 326
             VPP    ++ L P  +Y++ V C N +G S +  W+   T   AP   P N      +S
Sbjct: 1007 SVPPHVYRIQQLWPMADYNISVSCKNEVGWSAFSPWITASTTEGAPTTQPLNVTVSLNES 1186

Query: 327  GLILEWEEVIPE-DPGEGPLGPYKL--SWVQENGTQD---ELMVEGTRANLTDWDPQKDL 380
               LE   V P  +   G L  Y +  +W    G Q+   E     T A L         
Sbjct: 1187 SSFLEIRWVKPPLERTHGELQGYHIWHTWQDSKGLQNISLEAQPNATVAILPVVATNATC 1366

Query: 381  ILRVCASNAIGDGPWSQP---------LVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXX 431
             +RV A    G GP+S P         L+ SS       G   S    +  V G      
Sbjct: 1367 SVRVAAVTKGGVGPFSSPVEVFVPASGLITSSPSSTPASGNTDSFIVALGFVCGTVAVGL 1546

Query: 432  XXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGIS 491
                      +KR  ET++G AF       E  V++ A +S+ R     +E TL SLG+S
Sbjct: 1547 ILCLSVVI--QKRCMETKYGNAFSR--NDSELVVNYTAKKSYCRRA---VELTLGSLGVS 1705

Query: 492  DELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSD 551
             EL++KL+DV+I     +LG++LG+GEFGSV E +L Q +G+  KVAVK +K D  +  +
Sbjct: 1706 SELQQKLQDVVIDRNALSLGKVLGEGEFGSVMEGRLSQPEGTPQKVAVKTMKLDNFSHRE 1885

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            IEEFL EAACMK+FDHP+V KL+GV +   ++ ++P PMV+LPFMK+GDLH+FLL SR+ 
Sbjct: 1886 IEEFLSEAACMKDFDHPNVIKLLGVCIELSSQ-QIPKPMVVLPFMKYGDLHSFLLRSRLE 2062

Query: 612  ENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY 671
              P  +PLQ L++FMVDIA GMEYLSSR F+HRDLAARNCML +DMTVCVADFGLS+KIY
Sbjct: 2063 MAPQFVPLQMLLKFMVDIALGMEYLSSRQFLHRDLAARNCMLRDDMTVCVADFGLSKKIY 2242

Query: 672  SGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEI 731
            SGDYYRQG  +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N EI
Sbjct: 2243 SGDYYRQGRIAKMPVKWIAIESLADRVYTTKSDVWAFGVTMWEIATRGMTPYPGVQNHEI 2422

Query: 732  YNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQD 791
            Y YL  G RLK+P  C++E+YD+M  CW A+P  RP+F+ L++ LE +L  L     S+D
Sbjct: 2423 YEYLFHGQRLKKPENCLDELYDIMSSCWRAEPADRPTFSQLKVHLEKLLESLPAPRGSKD 2602

Query: 792  PLYINIERAEQPTES 806
             +Y+N    E+  +S
Sbjct: 2603 VIYVNTSLPEESPDS 2647
>emb|X72886.1|HSTYRO3 H.sapiens TYRO3 mRNA
          Length = 816

 Score =  551 bits (1420), Expect = e-154
 Identities = 269/272 (98%), Positives = 271/272 (98%)
 Frame = +1

Query: 509 TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
           TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP
Sbjct: 1   TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 180

Query: 569 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
           HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTL+RFMVD
Sbjct: 181 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVD 360

Query: 629 IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
           IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW
Sbjct: 361 IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 540

Query: 689 LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
           LALESLADNLYTV SDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM
Sbjct: 541 LALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 720

Query: 749 EEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           E+VYDLMYQCWSADPKQRPSFTCLRMELENIL
Sbjct: 721 EDVYDLMYQCWSADPKQRPSFTCLRMELENIL 816
>gb|BC008551.1| Mus musculus, clone IMAGE:3591640, mRNA
          Length = 3444

 Score =  518 bits (1335), Expect = e-145
 Identities = 277/590 (46%), Positives = 374/590 (62%), Gaps = 24/590 (4%)
 Frame = +3

Query: 233 VAWVPGADGLALLHSCTVQVAHAP---GEW--------EALAVVVPVPPFTCLLRNLAPA 281
           VAW PG  G+  L  C +Q   +    G W        + L + V VPP    L  L P 
Sbjct: 54  VAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPH 233

Query: 282 TNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPG 341
           T Y +R+ C+++ GPSP+  W+P +T    P   P+N  A+R  S +++ W+E  P  P 
Sbjct: 234 TPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQE--PRVPL 407

Query: 342 EGPLGPYKLSWVQENGTQDELMVEGTRANLT----DWDPQKDLILRVCASNAIGDGPWSQ 397
           +G L  Y+L++  ++ T + LM  G    +T       P  +L + V A  + GDGPWS 
Sbjct: 408 QGTLLGYRLAYRGQD-TPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSL 584

Query: 398 PLVVSSH--------DHAGRQGPPHSRT-SWVPVVLGVXXXXXXXXXXXXXXXRKRRKET 448
           P+ +            H   + PP + +  W  V+LG                 +R+KET
Sbjct: 585 PVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACVLILALFLVHRRKKET 764

Query: 449 RFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQF 508
           R+G+ F+  + RGE  V +R  +S++R   E   ATL+SLGIS+ELKEKL DV++   + 
Sbjct: 765 RYGEVFEPTVERGELVVRYRVRKSYSRRTTE---ATLNSLGISEELKEKLRDVMVDRHKV 935

Query: 509 TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            LG+ LG+GEFG+V E QL Q+D S +KVAVK +K  I   S++E+FL EA CMKEFDHP
Sbjct: 936 ALGKTLGEGEFGAVMEGQLNQDD-SILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHP 1112

Query: 569 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
           +V +L+GV  +   +   P P+VILPFMKHGDLH+FLL SR+G+ P  LP Q LV+FM D
Sbjct: 1113NVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQPVFLPTQMLVKFMAD 1292

Query: 629 IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
           IA GMEYLS++ FIHRDLAARNCML E+M+VCVADFGLS+KIY+GDYYRQG  +K+PVKW
Sbjct: 1293IASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKW 1472

Query: 689 LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
           +A+ESLAD +YT  SDVW+FGVTMWEI TRGQTPY G+EN+EIY+YL  GNRLKQP +C+
Sbjct: 1473IAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPVDCL 1652

Query: 749 EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIE 798
           + +Y LM +CW  +P+ RPSF  LR +LEN L  L       + LY+N++
Sbjct: 1653DGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDEILYVNMD 1802
>ref|XM_057391.1| Homo sapiens c-mer proto-oncogene tyrosine kinase (MERTK), mRNA
          Length = 2195

 Score =  443 bits (1139), Expect = e-122
 Identities = 230/449 (51%), Positives = 306/449 (67%), Gaps = 7/449 (1%)
 Frame = +1

Query: 360 DELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQP--LVVSSH---DHAGRQGPPH 414
           +E+   G+RA ++         +R+ A    G GP+S P  + + +H   D+A    P  
Sbjct: 13  EEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAPSSTPAP 192

Query: 415 SRTSWVPVVLGVX--XXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARS 472
                V ++ G                  RKR +ET+FG AF       E  V++ A +S
Sbjct: 193 GNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTE--EDSELVVNYIAKKS 366

Query: 473 FNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDG 532
           F R     IE TL SLG+S+EL+ KLEDV+I      LG++LG+GEFGSV E  LKQEDG
Sbjct: 367 FCRRA---IELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDG 537

Query: 533 SFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVI 592
           + +KVAVK +K D  +  +IEEFL EAACMK+F HP+V +L+GV +   ++G +P PMVI
Sbjct: 538 TSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQG-IPKPMVI 714

Query: 593 LPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCM 652
           LPFMK+GDLH +LL SR+   P ++PLQTL++FMVDIA GMEYLS+RNF+HRDLAARNCM
Sbjct: 715 LPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCM 894

Query: 653 LAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTM 712
           L +DMTVCVADFGLS+KIYSGDYYRQG  +K+PVKW+A+ESLAD +YT  SDVWAFGVTM
Sbjct: 895 LRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTM 1074

Query: 713 WEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCL 772
           WEI TRG TPY G++N E+Y+YL+ G+RLKQP +C++E+Y++MY CW  DP  RP+F+ L
Sbjct: 1075WEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVL 1254

Query: 773 RMELENILGHLSVLSTSQDPLYINIERAE 801
           R++LE +L  L  +    D +Y+N +  E
Sbjct: 1255RLQLEKLLESLPDVRNQADVIYVNTQLLE 1341
>ref|XR_000011.1| Homo sapiens TYRO3P protein tyrosine kinase pseudogene (TYRO3P),
           misc RNA
          Length = 864

 Score =  203 bits (516), Expect(3) = e-120
 Identities = 100/125 (80%), Positives = 101/125 (80%), Gaps = 19/125 (15%)
 Frame = +1

Query: 675 YYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNY 734
           YY  GCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN EIYNY
Sbjct: 490 YYC*GCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENTEIYNY 669

Query: 735 LIGGNRLKQPPECMEEV-------------------YDLMYQCWSADPKQRPSFTCLRME 775
           LIGGN LKQ PECME+V                   YDLMYQCWSADPKQRPSFTCLRME
Sbjct: 670 LIGGNHLKQLPECMEDVLTLPLHPSQGLLRPSDDLLYDLMYQCWSADPKQRPSFTCLRME 849

Query: 776 LENIL 780
           LENIL
Sbjct: 850 LENIL 864
 Score =  157 bits (398), Expect(3) = e-120
 Identities = 81/98 (82%), Positives = 85/98 (86%)
 Frame = +2

Query: 576 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
           +SL SRAKG  PIP+VILPFMKHGDLHAFLL S +GENPF     TL+RFMVDIAC MEY
Sbjct: 209 LSLWSRAKGCHPIPVVILPFMKHGDLHAFLLTSWLGENPF-----TLIRFMVDIACSMEY 373

Query: 636 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSG 673
           LSSRNFIHRDLAARNCMLA DMTVCVADFGLS KIYSG
Sbjct: 374 LSSRNFIHRDLAARNCMLAGDMTVCVADFGLSWKIYSG 487
 Score =  120 bits (301), Expect(3) = e-120
 Identities = 61/70 (87%), Positives = 65/70 (92%)
 Frame = +3

Query: 515 GKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
           GKGEFGSVR AQLKQEDGSFVKVA+KMLKAD+IASSDIEEFLR+AACMKEFDHPHVAKLV
Sbjct: 18  GKGEFGSVR*AQLKQEDGSFVKVAMKMLKADLIASSDIEEFLRKAACMKEFDHPHVAKLV 197

Query: 575 GVSLRSRAKG 584
           GVSL +   G
Sbjct: 198 GVSL*ASGAG 227
>emb|X72887.1|HSTYRO3Y H.sapiens TYRO3P mRNA
          Length = 864

 Score =  203 bits (516), Expect(3) = e-120
 Identities = 100/125 (80%), Positives = 101/125 (80%), Gaps = 19/125 (15%)
 Frame = +1

Query: 675 YYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNY 734
           YY  GCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN EIYNY
Sbjct: 490 YYC*GCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENTEIYNY 669

Query: 735 LIGGNRLKQPPECMEEV-------------------YDLMYQCWSADPKQRPSFTCLRME 775
           LIGGN LKQ PECME+V                   YDLMYQCWSADPKQRPSFTCLRME
Sbjct: 670 LIGGNHLKQLPECMEDVLTLPLHPSQGLLRPSDDLLYDLMYQCWSADPKQRPSFTCLRME 849

Query: 776 LENIL 780
           LENIL
Sbjct: 850 LENIL 864
 Score =  157 bits (398), Expect(3) = e-120
 Identities = 81/98 (82%), Positives = 85/98 (86%)
 Frame = +2

Query: 576 VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
           +SL SRAKG  PIP+VILPFMKHGDLHAFLL S +GENPF     TL+RFMVDIAC MEY
Sbjct: 209 LSLWSRAKGCHPIPVVILPFMKHGDLHAFLLTSWLGENPF-----TLIRFMVDIACSMEY 373

Query: 636 LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSG 673
           LSSRNFIHRDLAARNCMLA DMTVCVADFGLS KIYSG
Sbjct: 374 LSSRNFIHRDLAARNCMLAGDMTVCVADFGLSWKIYSG 487
 Score =  120 bits (301), Expect(3) = e-120
 Identities = 61/70 (87%), Positives = 65/70 (92%)
 Frame = +3

Query: 515 GKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
           GKGEFGSVR AQLKQEDGSFVKVA+KMLKAD+IASSDIEEFLR+AACMKEFDHPHVAKLV
Sbjct: 18  GKGEFGSVR*AQLKQEDGSFVKVAMKMLKADLIASSDIEEFLRKAACMKEFDHPHVAKLV 197

Query: 575 GVSLRSRAKG 584
           GVSL +   G
Sbjct: 198 GVSL*ASGAG 227
>gb|L11625.1|MUSRPTKA Mus musculus receptor tyrosine kinase mRNA, 3' end
          Length = 1951

 Score =  432 bits (1111), Expect = e-119
 Identities = 213/360 (59%), Positives = 274/360 (75%)
 Frame = +1

Query: 442 RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDV 501
           R+R +ET+FG AF       +  V++RA +SF R     IE TL SLG+S+EL+ KLEDV
Sbjct: 148 RRRVQETKFGGAFSE--EDSQLVVNYRAKKSFCRRA---IELTLQSLGVSEELQNKLEDV 312

Query: 502 LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAAC 561
           +I      LG++LG+GEFGSV E  LKQEDG+  KVAVK +K D  +  +IEEFL EAAC
Sbjct: 313 VIDRNLLVLGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIEEFLSEAAC 492

Query: 562 MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQT 621
           MK+F+HP+V +L+GV +   ++G +P PMVILPFMK+GDLH FLL SR+   P  + LQT
Sbjct: 493 MKDFNHPNVIRLLGVCIELSSQG-IPKPMVILPFMKYGDLHTFLLYSRLNTGPKYIHLQT 669

Query: 622 LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
           L++FM+DIA GMEYLS+RNF+HRDLAARNCML +DMTVCVADFGLS+KIYSGDYYRQG  
Sbjct: 670 LLKFMMDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRI 849

Query: 682 SKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRL 741
           +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI TRG TPY G++N E+Y+YL+ G+RL
Sbjct: 850 AKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEITTRGMTPYPGVQNHEMYDYLLHGHRL 1029

Query: 742 KQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAE 801
           KQP +C++E+YD+MY CWSADP  RP+F+ LR++LE +   L      +  +YIN +  E
Sbjct: 1030KQPEDCLDELYDIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESIIYINTQLLE 1209
>gb|M92847.1|AREVRYK Avian retrovirus tyrosine kinase (v-ryk) oncogene mRNA, complete cds,
            and glycoprotein 85 (gp85) mRNA, 3' end
          Length = 3010

 Score =  406 bits (1043), Expect = e-111
 Identities = 197/342 (57%), Positives = 259/342 (75%)
 Frame = +1

Query: 465  VHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVRE 524
            V++ A +S+ R     +E TL SLG+S EL++KL+DV+I     +LG++LG+GEFGSV E
Sbjct: 784  VNYTAKKSYCRRA---VELTLGSLGVSSELQQKLQDVVIDRNALSLGKVLGEGEFGSVME 954

Query: 525  AQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKG 584
             +L Q +G+  KVAVK +K D  +  +IEEFL EAAC+K+FDHP+V KL+GV +   ++ 
Sbjct: 955  GRLSQPEGTPQKVAVKTMKLDNFSHREIEEFLSEAACIKDFDHPNVIKLLGVCIELSSQ- 1131

Query: 585  RLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHR 644
            ++P PMV+LPFMK+GDLH+FLL SR+   P  +PLQ L++FMVDIA GMEYLSSR F+HR
Sbjct: 1132 QIPKPMVVLPFMKYGDLHSFLLRSRLEMAPQFVPLQMLLKFMVDIALGMEYLSSRQFLHR 1311

Query: 645  DLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSD 704
            DLAARNCML +DMTVCVADFGLS+KIYSGDYYRQG  +K+PVKW+A+ESLAD +YT  SD
Sbjct: 1312 DLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTTKSD 1491

Query: 705  VWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPK 764
            VWAFGVTMWEI TRG TPY G++N EIY YL  G RLK+P  C++E+YD+M  CW A+P 
Sbjct: 1492 VWAFGVTMWEIATRGMTPYPGVQNHEIYEYLFHGQRLKKPENCLDELYDIMSSCWRAEPA 1671

Query: 765  QRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTES 806
             RP+F+ L++ LE +L  L     S+D +Y+N    E+  +S
Sbjct: 1672 DRPTFSQLKVHLEKLLESLPAPRGSKDVIYVNTSLPEESPDS 1797
>gb|L08961.1|HUMSPRMTK Homo sapiens transmembrane tyrosine kinase mRNA, complete cds
          Length = 1872

 Score =  290 bits (741), Expect = 6e-76
 Identities = 189/424 (44%), Positives = 249/424 (58%), Gaps = 50/424 (11%)
 Frame = +1

Query: 442  RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDV 501
            RKR +ET+FG AF       E  V++ A +SF R     IE T  SLG+S+EL+ KLEDV
Sbjct: 613  RKRVQETKFGNAFTE--EDSELVVNYIAKKSFCRRA---IELT-HSLGVSEELQNKLEDV 774

Query: 502  LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEEFLREA 559
            +I      LG++LG+GE G+V E      +G  VK  VA+K LK D +A+ +I   L EA
Sbjct: 775  VIDRNLLILGKILGEGEKGTVYEGLWNIPEGKEVKIPVAIKTLKLDTMANKEI---LDEA 945

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
            + MK F +PHV +L+G+ + S     +     +L + ++ D  A    S   E   N PL
Sbjct: 946  SVMKGFGNPHVVRLLGICMTSTIY--VITEYCLLVYRRNKD-KAEQHRSNCAE--LNPPL 1110

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
            QTL++FMVDIA GMEYLS+RNF+HRDLAARNCML +DMTVCVADFGLS+KIYSGDYYRQG
Sbjct: 1111 QTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQG 1290

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMT--RGQTPYAGIENAEIYNYLIG 737
              +K+PVKW+A+ESLAD +YT  SDVWAFGVTMWEI T  RG TPY G++N E+Y+YL+ 
Sbjct: 1291 RIAKMPVKWIAIESLADRVYT-KSDVWAFGVTMWEIATTLRGMTPYPGVQNHEMYDYLLH 1467

Query: 738  GNRLKQPP---ECME-------------------EVYDL--------------MYQCWSA 761
            G+RLKQP     C E                    ++ +              M +C  A
Sbjct: 1468 GHRLKQPRTAWNCTEIRIRLLKLPILGSRTMRPMTIFSMATRLSSPKTAWMNCMKKCTLA 1647

Query: 762  D---PKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAE-------QPTESGSPEL 811
                PK  P+F+ LR++LE +L  L  +    D +Y+N +  E        P  +G    
Sbjct: 1648 GEPIPKTGPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESEGLARVHPCSTGLEHH 1827

Query: 812  HCGE 815
             C E
Sbjct: 1828 PCSE 1839
>gb|U77681.1|XLU77681 Xenopus laevis tyrosine kinase receptor mRNA, complete cds
          Length = 4433

 Score =  254 bits (648), Expect = 4e-65
 Identities = 147/337 (43%), Positives = 202/337 (59%), Gaps = 5/337 (1%)
 Frame = +2

Query: 478  PERIEATLDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFV 535
            P  + + +DSL    EL E+++DVLIPE+  T    R++GKG FGSV       ED   V
Sbjct: 3332 PILLASLVDSL--RPELLEEVKDVLIPERCLTTHRDRIIGKGHFGSVYHGTYVDEDQQEV 3505

Query: 536  KVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPF 595
              AVK L   I    ++EEFLRE   MK F HP+V  L+G+ L         +P+V+LPF
Sbjct: 3506 HCAVKSLNR-ITDLEEVEEFLREGILMKSFHHPNVLSLIGICLPQEG-----LPLVVLPF 3667

Query: 596  MKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAE 655
            MKHGDL  F+ +     NP    ++ LV F + ++ GMEYL++R F+HRDLAARNCML E
Sbjct: 3668 MKHGDLRHFIRSEE--RNP---TVKDLVGFGLQVSRGMEYLANRKFVHRDLAARNCMLDE 3832

Query: 656  DMTVCVADFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMW 713
               V VADFGL+R ++  +YY  R+   ++LPVKW+A+ESL    +T  SDVW+FGV +W
Sbjct: 3833 SFHVKVADFGLARDVFDKEYYSVRRHKNARLPVKWMAMESLQTQKFTTKSDVWSFGVLLW 4012

Query: 714  EIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLR 773
            E+MTRG  PY  ++  +I  YL  G RL QP  C   +Y LM  CW+  P +RP+FT L 
Sbjct: 4013 ELMTRGAPPYPDVDAYDITRYLFRGRRLAQPEYCPNPLYSLMLSCWNPQPVERPTFTQLV 4192

Query: 774  MELENILGHLS-VLSTSQDPLYINIERAEQPTESGSP 809
             ++E I   LS     + +  Y+N++  +QP   G P
Sbjct: 4193 SDMELISNSLSGDHYINLNVTYVNLD-CDQPFPPGHP 4300
>dbj|D87758.1|D87758 Xenopus laevis mRNA for Xron, complete cds
          Length = 4110

 Score =  253 bits (647), Expect = 5e-65
 Identities = 147/337 (43%), Positives = 202/337 (59%), Gaps = 5/337 (1%)
 Frame = +1

Query: 478  PERIEATLDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFV 535
            P  + + +DSL    EL E+++DVLIPE+  T    R++GKG FGSV       ED   V
Sbjct: 3079 PILLASLVDSL--RPELLEEVKDVLIPERCLTTHRDRIIGKGHFGSVYHGTYVDEDQQEV 3252

Query: 536  KVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPF 595
              AVK L   I    ++EEFLRE   MK F HP+V  L+G+ L         +P+V+LPF
Sbjct: 3253 HCAVKSLNR-ITDLEEVEEFLREGILMKSFHHPNVLSLIGICLPQEG-----LPLVVLPF 3414

Query: 596  MKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAE 655
            MKHGDL  F+ +     NP    ++ LV F + ++ GMEYL++R F+HRDLAARNCML E
Sbjct: 3415 MKHGDLRHFIRSEE--RNP---TVKDLVGFGLQVSRGMEYLANRKFVHRDLAARNCMLDE 3579

Query: 656  DMTVCVADFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMW 713
               V VADFGL+R ++  +YY  R+   ++LPVKW+A+ESL    +T  SDVW+FGV +W
Sbjct: 3580 TFHVKVADFGLARDVFDKEYYSVRRHKNARLPVKWMAMESLQTQKFTTKSDVWSFGVLLW 3759

Query: 714  EIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLR 773
            E+MTRG  PY  ++  +I  YL  G RL QP  C   +Y LM  CW+  P +RP+FT L 
Sbjct: 3760 ELMTRGAPPYPDVDAYDITRYLFRGRRLAQPEYCPNPLYSLMLSCWNPQPVERPTFTQLV 3939

Query: 774  MELENILGHLS-VLSTSQDPLYINIERAEQPTESGSP 809
             ++E I   LS     + +  Y+N++  +QP   G P
Sbjct: 3940 SDMELISNSLSGDHYINLNVTYVNLD-CDQPFPPGHP 4047
>gb|L12024.1|CHKCSEAX Gallus gallus protooncogene c-sea receptor, complete cds
          Length = 4567

 Score =  250 bits (639), Expect = 4e-64
 Identities = 138/321 (42%), Positives = 193/321 (59%), Gaps = 4/321 (1%)
 Frame = +1

Query: 493  ELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS 550
            EL E+++D+LIPE++      R++G+G FGSV            +  AVK L   I    
Sbjct: 3214 ELLEEVKDILIPEERLITHRSRVIGRGHFGSVYHGTYMDPLLGNLHCAVKSLHR-ITDLE 3390

Query: 551  DIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI 610
            ++EEFLRE   MK F HP V  L+GV L      R  +P+V+LP+M+HGDL  F+ A   
Sbjct: 3391 EVEEFLREGILMKSFHHPQVLSLLGVCLP-----RHGLPLVVLPYMRHGDLRHFIRAQER 3555

Query: 611  GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKI 670
                    ++ L+ F + +A GMEYL+ + F+HRDLAARNCML E +TV VADFGL+R +
Sbjct: 3556 SPT-----VKELIGFGLQVALGMEYLAQKKFVHRDLAARNCMLDETLTVKVADFGLARDV 3720

Query: 671  YSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN 728
            +  +YY  RQ   +KLPVKW+ALESL    +T  SDVW+FGV MWE++TRG +PY  ++ 
Sbjct: 3721 FGKEYYSIRQHRHAKLPVKWMALESLQTQKFTTKSDVWSFGVLMWELLTRGASPYPEVDP 3900

Query: 729  AEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
             ++  YL+ G RL QP  C + +Y +M  CW+  P++RPSF+ L  ELE +L  L     
Sbjct: 3901 YDMARYLLRGRRLPQPQPCPDTLYGVMLSCWAPTPEERPSFSGLVCELERVLASL----- 4065

Query: 789  SQDPLYINIERAEQPTESGSP 809
             +   Y+N+       ESG P
Sbjct: 4066 -EGERYVNLAVTYVNLESGPP 4125
>ref|XM_096924.1| Homo sapiens similar to TYRO3 protein tyrosine kinase (H. sapiens)
           (LOC146065), mRNA
          Length = 437

 Score =  249 bits (636), Expect = 9e-64
 Identities = 127/130 (97%), Positives = 128/130 (97%)
 Frame = -3

Query: 442 RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDV 501
           RKRRKETRFG AFDSVMARGEPAVHFRAARSFNRERPERIEAT+DSLGISDELKEKLEDV
Sbjct: 390 RKRRKETRFG*AFDSVMARGEPAVHFRAARSFNRERPERIEATVDSLGISDELKEKLEDV 211

Query: 502 LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAAC 561
           LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLK DIIASSDIEEFLREAAC
Sbjct: 210 LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKGDIIASSDIEEFLREAAC 31

Query: 562 MKEFDHPHVA 571
           MKEFDHPHVA
Sbjct: 30  MKEFDHPHVA 1
>gb|M25158.1|AC2TKSEA Avian retrovirus proviral tyrosine kinase (ENV-SEA oncogene), 3' end
          Length = 2538

 Score =  248 bits (632), Expect = 3e-63
 Identities = 138/321 (42%), Positives = 193/321 (59%), Gaps = 4/321 (1%)
 Frame = +1

Query: 493  ELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS 550
            EL E+++D+LIPE++      R++G+G FGSV            +  AVK L   I    
Sbjct: 805  ELLEEVKDILIPEERLITHRSRVIGRGHFGSVYHGTYMDPLLGNLHCAVKSLHR-ITYLE 981

Query: 551  DIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI 610
            ++EEFLRE   MK F HP V  L+GV L      R  +P+V+LP+M+HGDL  F+ A   
Sbjct: 982  EVEEFLREGILMKGFHHPQVLSLLGVCLP-----RHGLPLVVLPYMRHGDLRHFVRAQER 1146

Query: 611  GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKI 670
                    ++ L+ F + +A GMEYL+ + F+HRDLAARNCML E +TV VADFGL+R +
Sbjct: 1147 SPT-----VKELIGFGLQVALGMEYLAQKKFVHRDLAARNCMLDETLTVKVADFGLARDV 1311

Query: 671  YSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN 728
            +  +YY  RQ   +KLPV+W+ALESL    +T  SDVW+FGV MWE++TRG +PY  ++ 
Sbjct: 1312 FGKEYYSIRQHRHAKLPVRWMALESLQTQKFTTKSDVWSFGVLMWELLTRGASPYPEVDP 1491

Query: 729  AEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
             ++  YL+ G RL QP  C + +Y +M  CW+  P++RPSF+ L  ELE +L  L     
Sbjct: 1492 YDMARYLLRGRRLPQPQPCPDTLYGVMLSCWAPTPEERPSFSGLVCELERVLASL----- 1656

Query: 789  SQDPLYINIERAEQPTESGSP 809
             +   YIN+       ESG P
Sbjct: 1657 -EGEHYINMAVTYVNLESGPP 1716
>emb|Y18562.1|GCY18562 Geodia cydonium mRNA for scavenger receptor tyrosine kinase
          Length = 1916

 Score =  248 bits (632), Expect = 3e-63
 Identities = 137/326 (42%), Positives = 203/326 (62%), Gaps = 11/326 (3%)
 Frame = +2

Query: 498  LEDVLIPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEF 555
            L+ +L+ E Q  L   LG+G FG V +  +K   +D   V+VA+K LK DI    +I+ F
Sbjct: 809  LKGLLLAEDQLILTESLGEGAFGRVYKGSMKTGDDDDRTVEVAIKTLK-DISQQENIDNF 985

Query: 556  LREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR------ 609
            ++E+  M  F+HP+V +L+GV   +  +     P+++LPFM +GDL ++L++ R      
Sbjct: 986  VQESILMLGFNHPNVLELLGVCFDTTDRH----PLIVLPFMANGDLRSYLMSKRDPSVTT 1153

Query: 610  -IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSR 668
                 P  L  +  +   +++A GMEYLS+ +F+HRDLAARNCM++ ++TV VADFGLSR
Sbjct: 1154 KFTHFPQGLDEERALVMCLEVARGMEYLSNSSFVHRDLAARNCMVSGELTVRVADFGLSR 1333

Query: 669  KIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN 728
             +YS DYYR G  + LPVKW+A ESLADN++TV SDVW+FGV  WE+ +    PY GI N
Sbjct: 1334 DVYSKDYYRMGTKTMLPVKWMAPESLADNIFTVKSDVWSFGVVCWEVFSL-VAPYPGIGN 1510

Query: 729  AEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
             E+ +Y+ GG RLK P  C  E+Y+LM QCW+ +  +RP+F+ L  +LE       V+ T
Sbjct: 1511 HEMSDYIGGGRRLKIPRLCPREIYELMEQCWNEESNKRPNFSELVSQLER------VIDT 1672

Query: 789  SQDPLYINIER--AEQPTESGSPELH 812
              +P Y+N+     +Q   +  P+ H
Sbjct: 1673 RLNPHYMNMNNGTTQQNGHAVQPQ*H 1750
>dbj|AB027411.1|AB027411 Xenopus laevis mRNA for c-met/hepatocyte growth factor receptor,
            complete cds
          Length = 4128

 Score =  233 bits (595), Expect = 5e-59
 Identities = 132/334 (39%), Positives = 195/334 (57%), Gaps = 8/334 (2%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   +S +L +++E ++I   +  +   R++G+G  G V    L   DG  +  AVK L
Sbjct: 3139 IDISALSTDLMKEIEHMVIRVDRLIVHFNRVIGRGLSGCVSHGTLHDTDGKNIHCAVKSL 3318

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL+E   MK+F HP+V  L+G+ L +        P+V+LPFMKHGDL 
Sbjct: 3319 NR-ITDIEEVSQFLKEGIIMKDFSHPNVLSLLGICLPTEGS-----PLVVLPFMKHGDLR 3480

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GMEYL+S+ F+HRDLAARNC+L E+ TV VA
Sbjct: 3481 NF-----IRNETHNPTVKDLIGFGLQVAKGMEYLASKKFVHRDLAARNCILDENFTVKVA 3645

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FG+ +WE+MTRG 
Sbjct: 3646 DFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGILLWELMTRGA 3825

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI- 779
             PY  + + +I  YL+ G RL QP  C + ++++M +CW   P+ RP+F+ L   + +I 
Sbjct: 3826 PPYPDVNSFDITIYLLQGRRLLQPEYCPDPLFEVMLKCWHPRPELRPTFSELVSRISSIF 4005

Query: 780  ---LGHLSVLSTSQDPLYINIERAEQPTESGSPE 810
               LG   VL  +    Y+NI+ A       SPE
Sbjct: 4006 STFLGEHYVLFNA---TYVNIKCAAPYPSLLSPE 4098
>ref|NM_031517.1| Rattus norvegicus Met proto-oncogene (Met), mRNA
          Length = 4189

 Score =  232 bits (591), Expect = 1e-58
 Identities = 124/299 (41%), Positives = 176/299 (58%), Gaps = 4/299 (1%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3160 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDSDGKKIHCAVKSL 3339

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3340 NR-ITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3501

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3502 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3666

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3667 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 3846

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+ L   + +I
Sbjct: 3847 PPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSFSELVSRISSI 4023
>gb|U65007.1|RNU65007 Rattus norvegicus hepatocyte growth factor receptor mRNA, complete
            cds
          Length = 4189

 Score =  232 bits (591), Expect = 1e-58
 Identities = 124/299 (41%), Positives = 176/299 (58%), Gaps = 4/299 (1%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3160 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDSDGKKIHCAVKSL 3339

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3340 NR-ITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3501

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3502 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3666

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3667 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 3846

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+ L   + +I
Sbjct: 3847 PPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSFSELVSRISSI 4023
>ref|NM_008591.1| Mus musculus met proto-oncogene (Met), mRNA
          Length = 4140

 Score =  232 bits (591), Expect = 1e-58
 Identities = 124/299 (41%), Positives = 176/299 (58%), Gaps = 4/299 (1%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3151 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 3330

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3331 NR-ITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3492

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3493 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3657

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3658 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 3837

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+ L   + +I
Sbjct: 3838 PPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSFSELVSRISSI 4014
>emb|Y00671.1|MMMETONC Mouse mRNA of met proto-oncogene
          Length = 4140

 Score =  232 bits (591), Expect = 1e-58
 Identities = 124/299 (41%), Positives = 176/299 (58%), Gaps = 4/299 (1%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3151 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 3330

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3331 NR-ITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3492

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3493 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3657

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3658 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 3837

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+ L   + +I
Sbjct: 3838 PPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSFSELVSRISSI 4014
>emb|X54559.1|HSMETPRO Homo sapiens mRNA for met proto-oncogene
          Length = 4586

 Score =  231 bits (589), Expect = 2e-58
 Identities = 122/290 (42%), Positives = 172/290 (59%), Gaps = 4/290 (1%)
 Frame = +3

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3351 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 3530

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3531 NR-ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3692

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3693 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3857

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3858 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVVLWELMTRGA 4037

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+
Sbjct: 4038 PPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS 4187
>emb|X84044.1|GGRNACMET G.gallus mRNA for c-met
          Length = 4308

 Score =  231 bits (588), Expect = 3e-58
 Identities = 121/299 (40%), Positives = 179/299 (59%), Gaps = 4/299 (1%)
 Frame = +2

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ +L ++++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3281 IDISALNPDLVKEVQHVVIGADSLMVHFSEVIGRGHFGCVSHGTLLDNDGRKIHCAVKSL 3460

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL+E   MK+F HP+V  L+G+ L +        P+V+LP+MKHGDL 
Sbjct: 3461 NR-ITDLEEVAQFLKEGIIMKDFTHPNVLSLLGICLPNEGS-----PLVVLPYMKHGDLR 3622

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3623 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3787

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3788 DFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 3967

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             PY  + + +I  YL+ G RL QP  C + +Y++M +CW   P+ RP+F+ L  ++  I
Sbjct: 3968 PPYPDVNSFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKPEMRPAFSELVSKISTI 4144
>ref|NM_009074.1| Mus musculus macrophage stimulating 1 receptor (c-met-related
            tyrosine kinase) (Mst1r), mRNA
          Length = 4720

 Score =  231 bits (588), Expect = 3e-58
 Identities = 122/294 (41%), Positives = 180/294 (60%), Gaps = 4/294 (1%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSD 551
            L  +++DVLIP +Q  +   +++GKG FG V   +      +    A+K L   I    +
Sbjct: 3383 LLAEVKDVLIPHEQVVIHTDQVIGKGHFGVVYHGEYTDGAQNQTHCAIKSLSR-ITEVQE 3559

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            +E FLRE   M+   HP++  L+G+ L         +P V+LP+M+HGDL  F+ + +  
Sbjct: 3560 VEAFLREGLLMRGLHHPNILALIGIMLPPEG-----LPRVLLPYMRHGDLLRFIRSPQ-- 3718

Query: 612  ENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY 671
             NP    ++ LV F + +ACGMEYL+ + F+HRDLAARNCML E  TV VADFGL+R + 
Sbjct: 3719 RNP---TVKDLVSFGLQVACGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARGVL 3889

Query: 672  SGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
              +YY  RQ   ++LPVKW+ALESL    +T  SDVW+FGV +WE++TRG  PY  I+  
Sbjct: 3890 DKEYYSVRQHRHARLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYPHIDPF 4069

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHL 783
            ++ ++L  G RL QP  C + +Y +M +CW ADP  RP+F  L +E++ ++  L
Sbjct: 4070 DLSHFLAQGRRLPQPEYCPDSLYHVMLRCWEADPAARPTFRALVLEVKQVVASL 4231
>emb|X74736.1|MMRONRTK M.musculus mRNA for RON receptor tyrosine kinase
          Length = 4720

 Score =  231 bits (588), Expect = 3e-58
 Identities = 122/294 (41%), Positives = 180/294 (60%), Gaps = 4/294 (1%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSD 551
            L  +++DVLIP +Q  +   +++GKG FG V   +      +    A+K L   I    +
Sbjct: 3383 LLAEVKDVLIPHEQVVIHTDQVIGKGHFGVVYHGEYTDGAQNQTHCAIKSLSR-ITEVQE 3559

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            +E FLRE   M+   HP++  L+G+ L         +P V+LP+M+HGDL  F+ + +  
Sbjct: 3560 VEAFLREGLLMRGLHHPNILALIGIMLPPEG-----LPRVLLPYMRHGDLLRFIRSPQ-- 3718

Query: 612  ENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY 671
             NP    ++ LV F + +ACGMEYL+ + F+HRDLAARNCML E  TV VADFGL+R + 
Sbjct: 3719 RNP---TVKDLVSFGLQVACGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARGVL 3889

Query: 672  SGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
              +YY  RQ   ++LPVKW+ALESL    +T  SDVW+FGV +WE++TRG  PY  I+  
Sbjct: 3890 DKEYYSVRQHRHARLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYPHIDPF 4069

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHL 783
            ++ ++L  G RL QP  C + +Y +M +CW ADP  RP+F  L +E++ ++  L
Sbjct: 4070 DLSHFLAQGRRLPQPEYCPDSLYHVMLRCWEADPAARPTFRALVLEVKQVVASL 4231
>gb|U08818.1|HSU08818 Human activated met oncogene mRNA, partial cds
          Length = 1620

 Score =  231 bits (588), Expect = 3e-58
 Identities = 122/290 (42%), Positives = 172/290 (59%), Gaps = 4/290 (1%)
 Frame = +1

Query: 485 LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
           +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 352 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 531

Query: 543 KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
              I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 532 NR-ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 693

Query: 603 AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
            F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 694 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 858

Query: 663 DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 859 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 1038

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
            PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+
Sbjct: 1039PPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS 1188
>gb|U19348.1|HSU19348 Human (tpr-met fusion) oncogene mRNA, complete cds
          Length = 2016

 Score =  231 bits (588), Expect = 3e-58
 Identities = 122/290 (42%), Positives = 172/290 (59%), Gaps = 4/290 (1%)
 Frame = +2

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 812  IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 991

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 992  NR-ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 1153

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 1154 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVA 1318

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 1319 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 1498

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+
Sbjct: 1499 PPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS 1648
>ref|NM_000245.1| Homo sapiens met proto-oncogene (hepatocyte growth factor receptor)
            (MET), mRNA
          Length = 4620

 Score =  229 bits (583), Expect = 1e-57
 Identities = 121/290 (41%), Positives = 171/290 (58%), Gaps = 4/290 (1%)
 Frame = +3

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3399 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 3578

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3579 NR-ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3740

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A  M+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3741 NF-----IRNETHNPTVKDLIGFGLQVAKAMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3905

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3906 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVVLWELMTRGA 4085

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+
Sbjct: 4086 PPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS 4235
>gb|J02958.1|HUMMETPOA Human MET proto-oncogene mRNA, complete cds
          Length = 4626

 Score =  229 bits (583), Expect = 1e-57
 Identities = 121/290 (41%), Positives = 171/290 (58%), Gaps = 4/290 (1%)
 Frame = +3

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3405 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 3584

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3585 NR-ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3746

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A  M+YL+S+ F+HRDLAARNCML E  TV VA
Sbjct: 3747 NF-----IRNETHNPTVKDLIGFGLQVAKAMKYLASKKFVHRDLAARNCMLDEKFTVKVA 3911

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3912 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVVLWELMTRGA 4091

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPSF+
Sbjct: 4092 PPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS 4241
>emb|X96786.1|RNCMET r.norvegicus mRNA for HGF receptor
          Length = 4149

 Score =  227 bits (578), Expect = 5e-57
 Identities = 123/299 (41%), Positives = 173/299 (57%), Gaps = 4/299 (1%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + +  V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3160 IDLSALNPELVQAVPHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDSDGKKIHCAVKSL 3339

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3340 NR-ITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3501

Query: 603  AFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
             F     I     N  ++ L+ F + +A GM+YL S+ F+HRDLAARNCML E  TV VA
Sbjct: 3502 NF-----IRNETHNPTVKDLIGFGLQVAKGMKYLVSKKFVHRDLAARNCMLDEKFTVKVA 3666

Query: 663  DFGLSRKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            DFGL+R +Y  +YY       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG 
Sbjct: 3667 DFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA 3846

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             PY  +   +I  YL+ G RL QP  C + +Y++M +CW    + RPS + L   + +I
Sbjct: 3847 PPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSVSELVSRISSI 4023
>ref|NM_002447.1| Homo sapiens macrophage stimulating 1 receptor (c-met-related
            tyrosine kinase) (MST1R), mRNA
          Length = 4541

 Score =  226 bits (576), Expect = 8e-57
 Identities = 124/298 (41%), Positives = 180/298 (59%), Gaps = 4/298 (1%)
 Frame = +2

Query: 490  ISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADII 547
            +   L  +++DVLIP ++      R++GKG FG V   +   +  + ++ A+K L   I 
Sbjct: 3212 LDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSR-IT 3388

Query: 548  ASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
                +E FLRE   M+  +HP+V  L+G+ L         +P V+LP+M HGDL  F+ +
Sbjct: 3389 EMQQVEAFLREGLLMRGLNHPNVLALIGIMLPPEG-----LPHVLLPYMCHGDLLQFIRS 3553

Query: 608  SRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
             +   NP    ++ L+ F + +A GMEYL+ + F+HRDLAARNCML E  TV VADFGL+
Sbjct: 3554 PQ--RNP---TVKDLISFGLQVARGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLA 3718

Query: 668  RKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
            R I   +YY  +Q   ++LPVKW+ALESL    +T  SDVW+FGV +WE++TRG  PY  
Sbjct: 3719 RDILDREYYSVQQHRHARLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRH 3898

Query: 726  IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHL 783
            I+  ++ ++L  G RL QP  C + +Y +M QCW ADP  RP+F  L  E+E I+  L
Sbjct: 3899 IDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSAL 4072
>emb|X70040.1|HSRON H.sapiens RON mRNA for tyrosine kinase
          Length = 4541

 Score =  226 bits (576), Expect = 8e-57
 Identities = 124/298 (41%), Positives = 180/298 (59%), Gaps = 4/298 (1%)
 Frame = +2

Query: 490  ISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADII 547
            +   L  +++DVLIP ++      R++GKG FG V   +   +  + ++ A+K L   I 
Sbjct: 3212 LDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSR-IT 3388

Query: 548  ASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
                +E FLRE   M+  +HP+V  L+G+ L         +P V+LP+M HGDL  F+ +
Sbjct: 3389 EMQQVEAFLREGLLMRGLNHPNVLALIGIMLPPEG-----LPHVLLPYMCHGDLLQFIRS 3553

Query: 608  SRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
             +   NP    ++ L+ F + +A GMEYL+ + F+HRDLAARNCML E  TV VADFGL+
Sbjct: 3554 PQ--RNP---TVKDLISFGLQVARGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLA 3718

Query: 668  RKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
            R I   +YY  +Q   ++LPVKW+ALESL    +T  SDVW+FGV +WE++TRG  PY  
Sbjct: 3719 RDILDREYYSVQQHRHARLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRH 3898

Query: 726  IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHL 783
            I+  ++ ++L  G RL QP  C + +Y +M QCW ADP  RP+F  L  E+E I+  L
Sbjct: 3899 IDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSAL 4072
>ref|XM_011068.4| Homo sapiens macrophage stimulating 1 receptor (c-met-related
            tyrosine kinase) (MST1R), mRNA
          Length = 4533

 Score =  226 bits (575), Expect = 1e-56
 Identities = 124/298 (41%), Positives = 180/298 (59%), Gaps = 4/298 (1%)
 Frame = +2

Query: 490  ISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADII 547
            +   L  +++DVLIP ++      R++GKG FG V   +   +  + ++ A+K L   I 
Sbjct: 3212 LDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSR-IT 3388

Query: 548  ASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
                +E FLRE   M+  +HP+V  L+G+ L         +P V+LP+M HGDL  F+ +
Sbjct: 3389 EMQQVEAFLREGLLMRGLNHPNVLALIGIMLPPEG-----LPHVLLPYMCHGDLLQFIRS 3553

Query: 608  SRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
             +   NP    ++ L+ F + +A GMEYL+ + F+HRDLAARNCML E  TV VADFGL+
Sbjct: 3554 PQ--RNP---TVKDLISFGLQVARGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLA 3718

Query: 668  RKIYSGDYY--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
            R I   +YY  +Q   ++LPVKW+ALESL    +T  SDVW+FGV +WE++TRG  PY  
Sbjct: 3719 RDILDREYYSVQQHRHARLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRH 3898

Query: 726  IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHL 783
            I+  ++ ++L  G RL QP  C + +Y +M QCW ADP  RP+F  L  E+E I+  L
Sbjct: 3899 IDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAVRPTFGVLVGEVEQIVSAL 4072
>gb|AF111857.1|AF111857 Gallus gallus insulin receptor precursor, mRNA, partial cds
          Length = 3235

 Score =  221 bits (562), Expect = 3e-55
 Identities = 134/394 (34%), Positives = 206/394 (52%), Gaps = 6/394 (1%)
 Frame = +1

Query: 382  LRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXX 441
            +R+ A++  G+G W++P      D+   Q  P+     VP++  +               
Sbjct: 1606 VRIRATSLAGNGSWTEPTYFYVADYLNAQ--PNIAVIIVPIIFAIIIAGIIGAAYVLV-- 1773

Query: 442  RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDV 501
            +KR+ E   G  + S                     PE + A+   + + DE +      
Sbjct: 1774 KKRQTEGPTGPLYAS-------------------SNPEYLSAS--DVYVPDEWE------ 1872

Query: 502  LIPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREA 559
             +P ++ TL R LG+G FG V E   K   +     +VAVK +         IE FL EA
Sbjct: 1873 -VPREKITLLRELGQGSFGMVYEGIAKDIVKGELETRVAVKTVNESASLRERIE-FLNEA 2046

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNL 617
            + MK F   HV +L+GV  + +        +V++  M HGD  ++L + R     NP   
Sbjct: 2047 SVMKGFICHHVVRLLGVVSKGQPT------LVVMELMAHGDFKSYLRSLRPDAENNPGRP 2208

Query: 618  P--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDY 675
            P  L+ +++   +IA GM YL+++ F+HRDLAARNCM+AED TV + DFG++R IY  DY
Sbjct: 2209 PPTLREMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDY 2388

Query: 676  YRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYL 735
            YR+G    LPV+W+A ESL D ++T +SDVW+FGV +WEI +  + PY G+ N ++  ++
Sbjct: 2389 YRKGGKGLLPVRWMAPESLKDGVFTTYSDVWSFGVVLWEISSLAEQPYQGLSNEQVLKFV 2568

Query: 736  IGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            + G  L QP  C E +++LM  CW  +PK RP+F
Sbjct: 2569 MDGGYLDQPDNCPERLHNLMQMCWQYNPKMRPTF 2670
>ref|XM_048918.1| Homo sapiens met proto-oncogene (hepatocyte growth factor receptor)
            (MET), mRNA
          Length = 4632

 Score =  165 bits (418), Expect(2) = 4e-55
 Identities = 78/157 (49%), Positives = 106/157 (66%), Gaps = 2/157 (1%)
 Frame = +2

Query: 616  NLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDY 675
            N  ++ L+ F + +A GM+YL+S+ F+HRDLAARNCML E  TV VADFGL+R +Y  +Y
Sbjct: 3764 NPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEY 3943

Query: 676  Y--RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYN 733
            Y       +KLPVKW+ALESL    +T  SDVW+FGV +WE+MTRG  PY  +   +I  
Sbjct: 3944 YSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITV 4123

Query: 734  YLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
            YL+ G RL QP  C + +Y++M +CW    + RPSF+
Sbjct: 4124 YLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS 4234
 Score = 77.0 bits (188), Expect(2) = 4e-55
 Identities = 43/123 (34%), Positives = 66/123 (52%), Gaps = 2/123 (1%)
 Frame = +1

Query: 485  LDSLGISDELKEKLEDVLIPEQQFTL--GRMLGKGEFGSVREAQLKQEDGSFVKVAVKML 542
            +D   ++ EL + ++ V+I      +    ++G+G FG V    L   DG  +  AVK L
Sbjct: 3397 IDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSL 3576

Query: 543  KADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLH 602
               I    ++ +FL E   MK+F HP+V  L+G+ LRS        P+V+LP+MKHGDL 
Sbjct: 3577 NR-ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGS-----PLVVLPYMKHGDLR 3738

Query: 603  AFL 605
             F+
Sbjct: 3739 NFI 3747
>gb|AY043191.1| Danio rerio insulin-like growth factor I receptor mRNA, partial cds
          Length = 3285

 Score =  219 bits (559), Expect = 7e-55
 Identities = 134/393 (34%), Positives = 205/393 (52%), Gaps = 5/393 (1%)
 Frame = +3

Query: 382 LRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXX 441
           +RV A++  G+G W++P+  S H        P    + +P +L +               
Sbjct: 78  VRVRATSLAGNGSWTEPIAFSVHQLEQSSYDPVIFIAILPALLLI----AGLVVFGYTWM 245

Query: 442 RKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDV 501
            K R   R G   + V+       +F AA  +                + DE +      
Sbjct: 246 NKNRNNDRLG---NGVLYASVNPEYFSAAEMY----------------VPDEWE------ 350

Query: 502 LIPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            +  ++ T+ R LG+G FG V E   K   +D    +VA+K +         I EFL EA
Sbjct: 351 -VEREKITMCRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNESASLHERI-EFLNEA 524

Query: 560 ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNL-- 617
           + MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  EN  +L  
Sbjct: 525 SVMKEFNCHHVVRLLGVVSQGQP------TLVIMELMTRGDLKSYLRSLRSVENTSSLPL 686

Query: 618 -PLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            PL+ +++   +IA GM YL++  F+HRDLAARNCM+AED  V + DFG++R IY  DYY
Sbjct: 687 PPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFIVKIGDFGMTRDIYETDYY 866

Query: 677 RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
           R+G    LPV+W++ ESL D ++T  SDVW+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 867 RKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVM 1046

Query: 737 GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 1047EGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 1145
>emb|AJ223164.1|GGAJ3164 Gallus gallus IGF receptor type 1 cDNA
          Length = 4698

 Score =  218 bits (556), Expect = 2e-54
 Identities = 114/273 (41%), Positives = 168/273 (60%), Gaps = 6/273 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ T+ R LG+G FG V E   K   +D    +VA+K +         IE FL EA+
Sbjct: 3128 VPREKITMCRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNESASMRERIE-FLNEAS 3304

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R     NP   P
Sbjct: 3305 VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPDTESNPGQAP 3466

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              L+ +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++R IY  DYY
Sbjct: 3467 PTLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYY 3646

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 3647 RKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGMTNEQVLRFVM 3826

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             G  L++P  C + +++LM  CW  +PK RPSF
Sbjct: 3827 EGGLLEKPDNCPDMLFELMRMCWQYNPKMRPSF 3925
>gb|AF216772.2|AF216772 Carassius auratus insulin-like growth factor 1 receptor 1 mRNA,
            partial cds
          Length = 2373

 Score =  218 bits (555), Expect = 2e-54
 Identities = 115/272 (42%), Positives = 165/272 (60%), Gaps = 5/272 (1%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++ T+ R LG+G FG V E   K   +D    KVA+K +         IE FL EA+
Sbjct: 802  VEREKITMCRELGQGSFGMVYEGIAKGVVKDEPETKVAIKTVNESASLHERIE-FLNEAS 978

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQ 620
             MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  EN  +LPL 
Sbjct: 979  VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRSAENTSSLPLP 1140

Query: 621  TL---VRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L   ++   +IA GM YL +  F+HRDLAARNCM+AED TV + DFG++R IY  DYYR
Sbjct: 1141 PLKKMIQMAGEIADGMAYLHANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYR 1320

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W++ ESL D ++T  SDVW+FGV +WEI T  + PY G+ N ++  +++ 
Sbjct: 1321 KGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVME 1500

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 1501 GGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 1596
>ref|NM_070710.1| Eukaryotic protein kinase domain
          Length = 1329

 Score =  218 bits (555), Expect = 2e-54
 Identities = 117/296 (39%), Positives = 176/296 (58%), Gaps = 5/296 (1%)
 Frame = +1

Query: 490 ISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIAS 549
           I  +L++ L+ +L+P +   L  ++GKG FG+V   +++   G  + VAVK LK +    
Sbjct: 352 IGSDLRQSLQGLLLPSEAVVLETIVGKGYFGNVYRGRMRDPAGRLIPVAVKTLKGERARD 531

Query: 550 -SDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLAS 608
            + IE+FLRE   MK  DHPHV  L+G+S+          P V+LP+M+ GDL  +    
Sbjct: 532 IAHIEKFLREGVVMKHLDHPHVLSLLGISISPAGN-----PWVVLPYMEGGDLKTY---- 684

Query: 609 RIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSR 668
            I +    L +  L+ F   +A GM YL++++F+HRDLAARNCM++ D  V VADFGL+ 
Sbjct: 685 -IADPNRALCVLELLDFAHQVAQGMSYLAAQHFVHRDLAARNCMISADRIVKVADFGLAV 861

Query: 669 KIYSGDYY---RQGCASKLPVKWLALESLADN-LYTVHSDVWAFGVTMWEIMTRGQTPYA 724
            +   + Y    +   ++LP+KWLA ESL D  +++  +DVW+FGV MWE++TR  +PY 
Sbjct: 862 DLLDKESYIDESETGPARLPLKWLAPESLRDRRVFSSATDVWSFGVLMWELLTRAASPYG 1041

Query: 725 GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            + N ++ +YL  G RL QP  C + +YDLM  CW + P+ RP F  L   L  +L
Sbjct: 1042EVSNTKVRHYLETGMRLPQPTHCPDIIYDLMQCCWRSTPEDRPDFVFLSHRLRALL 1209
>emb|AJ224994.1|PMA224994 Psetta maxima mRNA for insulin receptor, alpha and beta subunits
          Length = 4168

 Score =  218 bits (554), Expect = 3e-54
 Identities = 114/274 (41%), Positives = 164/274 (59%), Gaps = 7/274 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ T+ R LG+G FG V E   K   +     +VAVK +         IE FL EA+
Sbjct: 2639 VPREKITVLRELGQGSFGMVYEGIAKDIIKGDPDTRVAVKTVNESASLRERIE-FLNEAS 2815

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFL--LASRIGENPFNLP 618
             MK F   HV +L+GV  +++        +V++  M HGDL ++L  L S    NP   P
Sbjct: 2816 VMKAFSCHHVVRLLGVVSKAQPT------LVVMELMTHGDLKSYLRCLRSDSENNPTGRP 2977

Query: 619  ---LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDY 675
               L+ +++   +IA GM YL+++ F+HRDLAARNCM+AED TV + DFG++R IY  DY
Sbjct: 2978 PPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDY 3157

Query: 676  YRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYL 735
            YR+G    LPV+W+A ESL D ++T HSD W+FGV +WEI T  + PY G+ N ++  ++
Sbjct: 3158 YRKGGKGLLPVRWMAPESLKDGVFTPHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFV 3337

Query: 736  IGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            + G  L +P  C E ++ LM  CW  +PK RP F
Sbjct: 3338 MDGGYLDRPENCPERMHSLMQMCWQYNPKMRPMF 3439
>emb|X54980.1|BTIGF1B B.taurus mRNA for insulin-like growth factor-1 receptor, beta-subunit
          Length = 1952

 Score =  217 bits (553), Expect = 4e-54
 Identities = 115/282 (40%), Positives = 172/282 (60%), Gaps = 12/282 (4%)
 Frame = +1

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 772  DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 948

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-- 609
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 949  RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 1110

Query: 610  IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            +  NP   P  L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++
Sbjct: 1111 MENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMT 1290

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R IY  DYYR+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ 
Sbjct: 1291 RDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLS 1470

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 1471 NEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 1596
>gb|M13013.1|CHKROS Chicken c-ros proto-oncogene, partial cds
          Length = 1280

 Score =  217 bits (553), Expect = 4e-54
 Identities = 122/288 (42%), Positives = 169/288 (58%), Gaps = 12/288 (4%)
 Frame = +3

Query: 504 PEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFV-KVAVKMLKADIIASSDIEEFLREAA 560
           P  +  L ++LG G FG V E        DGS   +VAVK LK       +  EFL+EA 
Sbjct: 270 PRDKLNLHKLLGSGAFGEVYEGTALDILADGSGESRVAVKTLKRGA-TDQEKSEFLKEAH 446

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQ 620
            M +FDHPH+ KL+GV L +  +       +IL  M+ GDL ++L  +R  +  F  PL 
Sbjct: 447 LMSKFDHPHILKLLGVCLLNEPQ------YLILELMEGGDLLSYLRGAR--KQKFQSPLL 602

Query: 621 TLVRFM---VDIACGMEYLSSRNFIHRDLAARNCMLAEDM------TVCVADFGLSRKIY 671
           TL   +   +DI  G  YL    FIHRDLAARNC+++E         V + DFGL+R IY
Sbjct: 603 TLTDLLDICLDICKGCVYLEKMRFIHRDLAARNCLVSEKQYGSCSRVVKIGDFGLARDIY 782

Query: 672 SGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEI 731
             DYYR+     LPV+W+A ESL D ++T HSDVWAFGV +WE +T GQ PY G+ N E+
Sbjct: 783 KNDYYRKRGEGLLPVRWMAPESLIDGVFTNHSDVWAFGVLVWETLTLGQQPYPGLSNIEV 962

Query: 732 YNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
            +++  G RL+ P  C +++ DLM +CW+ DP  RP+F  ++ +L+ I
Sbjct: 963 LHHVRSGGRLESPNNCPDDIRDLMTRCWAQDPHNRPTFFYIQHKLQEI 1106
>dbj|AB003362.2|AB003362 Sus scrofa mRNA for IGF-1 receptor, complete cds
          Length = 4236

 Score =  217 bits (553), Expect = 4e-54
 Identities = 115/282 (40%), Positives = 172/282 (60%), Gaps = 12/282 (4%)
 Frame = +2

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 2981 DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 3157

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-- 609
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 3158 RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 3319

Query: 610  IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            +  NP   P  L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++
Sbjct: 3320 MENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMT 3499

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R IY  DYYR+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ 
Sbjct: 3500 RDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLS 3679

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 3680 NEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 3805
>gb|M10455.1|ACSUR2CG Avian sarcoma virus UR2, complete genome
          Length = 3166

 Score =  217 bits (553), Expect = 4e-54
 Identities = 122/288 (42%), Positives = 169/288 (58%), Gaps = 12/288 (4%)
 Frame = +2

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFV-KVAVKMLKADIIASSDIEEFLREAA 560
            P  +  L ++LG G FG V E        DGS   +VAVK LK       +  EFL+EA 
Sbjct: 1109 PRDKLNLHKLLGSGAFGEVYEGTALDILADGSGESRVAVKTLKRGA-TDQEKSEFLKEAH 1285

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQ 620
             M +FDHPH+ KL+GV L +  +       +IL  M+ GDL ++L  +R  +  F  PL 
Sbjct: 1286 LMSKFDHPHILKLLGVCLLNEPQ------YLILELMEGGDLLSYLRGAR--KQKFQSPLL 1441

Query: 621  TLVRFM---VDIACGMEYLSSRNFIHRDLAARNCMLAEDM------TVCVADFGLSRKIY 671
            TL   +   +DI  G  YL    FIHRDLAARNC+++E         V + DFGL+R IY
Sbjct: 1442 TLTDLLDICLDICKGCVYLEKMRFIHRDLAARNCLVSEKQYGSCSRVVKIGDFGLARDIY 1621

Query: 672  SGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEI 731
              DYYR+     LPV+W+A ESL D ++T HSDVWAFGV +WE +T GQ PY G+ N E+
Sbjct: 1622 KNDYYRKRGEGLLPVRWMAPESLIDGVFTNHSDVWAFGVLVWETLTLGQQPYPGLSNIEV 1801

Query: 732  YNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
             +++  G RL+ P  C +++ DLM +CW+ DP  RP+F  ++ +L+ I
Sbjct: 1802 LHHVRSGGRLESPNNCPDDIRDLMTRCWAQDPHNRPTFFYIQHKLQEI 1945
>gb|M35104.1|RATCROS1A Rat lung-derived c-ros-1 proto-oncogene mRNA, complete cds
          Length = 7839

 Score =  217 bits (553), Expect = 4e-54
 Identities = 166/541 (30%), Positives = 267/541 (48%), Gaps = 32/541 (5%)
 Frame = +3

Query: 269  PPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGL 328
            P + C + NL P T Y++RV      G +       F+TK   P++       +   S  
Sbjct: 5442 PVYVCNIANLQPYTPYNIRVVVVYTTGENSSSIPESFKTKAGVPSKP--GIPKLLEGSKN 5615

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQE--NGTQDELM-----VEGTRANLTDWDPQK--- 378
             ++WE+   ED G   L  Y L   +   N ++D+ +       G+ +++  W  +    
Sbjct: 5616 SIQWEKA--EDNGNR-LMYYTLEVRKSISNDSRDQSLRWTAVFNGSCSSICTWRSKNLKG 5786

Query: 379  DLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV-PVVLGVXXXXXXXXXXX 437
                R  ASNAIG G +S+   +S        G   + TS++  +++G+           
Sbjct: 5787 TFQFRAVASNAIGFGEYSE---ISEDITLVEDGFWITETSFILTIIVGIFLVATVPLTFV 5957

Query: 438  XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL--- 494
                 K  K T+ G +                  + N +    +      +G+++     
Sbjct: 5958 WHRSLKNHKATKEGLS----------------VLNDNDQELAELRGLAAGVGLANACYAV 6089

Query: 495  -----KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKAD 545
                 +E++E +   P ++ +L  +LG G FG V E     +       +KVAVK LK  
Sbjct: 6090 HTLPTQEEIESLPAFPREKLSLRLLLGSGAFGEVYEGTAVDILGRGSGEIKVAVKTLKK- 6266

Query: 546  IIASSDIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHA 603
               S+D E  EFL+EA  M +F+HP++ K +GV L S  +       +IL  M+ GDL +
Sbjct: 6267 --GSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLSEPQ------YIILELMEGGDLLS 6422

Query: 604  FLLASR--IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT-- 658
            +L  +R      P  L L  LV   VDI+ G  YL   +FIHRDLAARNC+++ +D T  
Sbjct: 6423 YLRKARGTTLSGPL-LTLADLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSP 6599

Query: 659  --VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIM 716
              V + DFGL+R+IY  DYYR+     LPV+W+A E+L D ++T  SDVW+FG+ +WEI+
Sbjct: 6600 RVVKIGDFGLAREIYKHDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEIL 6779

Query: 717  TRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
            T G  PY    N ++ NY+  G RL+ P  C +++++LM++CW+ +P QRP+F  ++ +L
Sbjct: 6780 TLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMFRCWAQEPDQRPTFYNIQDQL 6959

Query: 777  E 777
            +
Sbjct: 6960 Q 6962
>ref|NM_012874.1| Rattus norvegicus Rat heart - derived c - ros - 1 proto - oncogene
            (Ros1), mRNA
          Length = 7902

 Score =  217 bits (553), Expect = 4e-54
 Identities = 166/541 (30%), Positives = 267/541 (48%), Gaps = 32/541 (5%)
 Frame = +3

Query: 269  PPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGL 328
            P + C + NL P T Y++RV      G +       F+TK   P++       +   S  
Sbjct: 5505 PVYVCNIANLQPYTPYNIRVVVVYTTGENSSSIPESFKTKAGVPSKP--GIPKLLEGSKN 5678

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQE--NGTQDELM-----VEGTRANLTDWDPQK--- 378
             ++WE+   ED G   L  Y L   +   N ++D+ +       G+ +++  W  +    
Sbjct: 5679 SIQWEKA--EDNGNR-LMYYTLEVRKSISNDSRDQSLRWTAVFNGSCSSICTWRSKNLKG 5849

Query: 379  DLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV-PVVLGVXXXXXXXXXXX 437
                R  ASNAIG G +S+   +S        G   + TS++  +++G+           
Sbjct: 5850 TFQFRAVASNAIGFGEYSE---ISEDITLVEDGFWITETSFILTIIVGIFLVATVPLTFV 6020

Query: 438  XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL--- 494
                 K  K T+ G +                  + N +    +      +G+++     
Sbjct: 6021 WHRSLKNHKATKEGLS----------------VLNDNDQELAELRGLAAGVGLANACYAV 6152

Query: 495  -----KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKAD 545
                 +E++E +   P ++ +L  +LG G FG V E     +       +KVAVK LK  
Sbjct: 6153 HTLPTQEEIESLPAFPREKLSLRLLLGSGAFGEVYEGTAVDILGRGSGEIKVAVKTLKK- 6329

Query: 546  IIASSDIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHA 603
               S+D E  EFL+EA  M +F+HP++ K +GV L S  +       +IL  M+ GDL +
Sbjct: 6330 --GSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLSEPQ------YIILELMEGGDLLS 6485

Query: 604  FLLASR--IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT-- 658
            +L  +R      P  L L  LV   VDI+ G  YL   +FIHRDLAARNC+++ +D T  
Sbjct: 6486 YLRKARGTTLSGPL-LTLADLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSP 6662

Query: 659  --VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIM 716
              V + DFGL+R+IY  DYYR+     LPV+W+A E+L D ++T  SDVW+FG+ +WEI+
Sbjct: 6663 RVVKIGDFGLAREIYKHDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEIL 6842

Query: 717  TRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
            T G  PY    N ++ NY+  G RL+ P  C +++++LM++CW+ +P QRP+F  ++ +L
Sbjct: 6843 TLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMFRCWAQEPDQRPTFYNIQDQL 7022

Query: 777  E 777
            +
Sbjct: 7023 Q 7025
>gb|M35106.1|RATCROS1C Rat heart-derived c-ros-1 proto-oncogene mRNA, complete cds
          Length = 7902

 Score =  217 bits (553), Expect = 4e-54
 Identities = 166/541 (30%), Positives = 267/541 (48%), Gaps = 32/541 (5%)
 Frame = +3

Query: 269  PPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGL 328
            P + C + NL P T Y++RV      G +       F+TK   P++       +   S  
Sbjct: 5505 PVYVCNIANLQPYTPYNIRVVVVYTTGENSSSIPESFKTKAGVPSKP--GIPKLLEGSKN 5678

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQE--NGTQDELM-----VEGTRANLTDWDPQK--- 378
             ++WE+   ED G   L  Y L   +   N ++D+ +       G+ +++  W  +    
Sbjct: 5679 SIQWEKA--EDNGNR-LMYYTLEVRKSISNDSRDQSLRWTAVFNGSCSSICTWRSKNLKG 5849

Query: 379  DLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV-PVVLGVXXXXXXXXXXX 437
                R  ASNAIG G +S+   +S        G   + TS++  +++G+           
Sbjct: 5850 TFQFRAVASNAIGFGEYSE---ISEDITLVEDGFWITETSFILTIIVGIFLVATVPLTFV 6020

Query: 438  XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL--- 494
                 K  K T+ G +                  + N +    +      +G+++     
Sbjct: 6021 WHRSLKNHKATKEGLS----------------VLNDNDQELAELRGLAAGVGLANACYAV 6152

Query: 495  -----KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKAD 545
                 +E++E +   P ++ +L  +LG G FG V E     +       +KVAVK LK  
Sbjct: 6153 HTLPTQEEIESLPAFPREKLSLRLLLGSGAFGEVYEGTAVDILGRGSGEIKVAVKTLKK- 6329

Query: 546  IIASSDIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHA 603
               S+D E  EFL+EA  M +F+HP++ K +GV L S  +       +IL  M+ GDL +
Sbjct: 6330 --GSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLSEPQ------YIILELMEGGDLLS 6485

Query: 604  FLLASR--IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT-- 658
            +L  +R      P  L L  LV   VDI+ G  YL   +FIHRDLAARNC+++ +D T  
Sbjct: 6486 YLRKARGTTLSGPL-LTLADLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSP 6662

Query: 659  --VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIM 716
              V + DFGL+R+IY  DYYR+     LPV+W+A E+L D ++T  SDVW+FG+ +WEI+
Sbjct: 6663 RVVKIGDFGLAREIYKHDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEIL 6842

Query: 717  TRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
            T G  PY    N ++ NY+  G RL+ P  C +++++LM++CW+ +P QRP+F  ++ +L
Sbjct: 6843 TLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMFRCWAQEPDQRPTFYNIQDQL 7022

Query: 777  E 777
            +
Sbjct: 7023 Q 7025
>emb|Z50155.1|XLIGF1R X.laevis mRNA for insulin-like growth factor I receptor
          Length = 3631

 Score =  216 bits (549), Expect = 1e-53
 Identities = 111/275 (40%), Positives = 172/275 (62%), Gaps = 8/275 (2%)
 Frame = +2

Query: 503 IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
           +P ++ T+ R LG+G FG V E   K   +D +  KVA+K +  +  +  +  EFL EA+
Sbjct: 722 VPREKITMNRELGQGSFGMVYEGIAKGVVKDEAETKVAIKTVN-EAASMRERIEFLNEAS 898

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA------SRIGENP 614
            MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L +      S  G++P
Sbjct: 899 VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPDTESNSGQSP 1060

Query: 615 FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGD 674
            +L  + +++   +IA GM YL++  F+HRDLAARNCM+ ED TV + DFG++R IY  D
Sbjct: 1061PSL--KKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVTEDFTVKIGDFGMTRDIYETD 1234

Query: 675 YYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNY 734
           YYR+G    LPV+W++ ESL D ++T +SDVW+FGV +WEI T  + PY G+ N ++  +
Sbjct: 1235YYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRF 1414

Query: 735 LIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
           ++ G  L++P  C + +++LM  CW  +PK RPSF
Sbjct: 1415VMEGGLLEKPDNCPDMLFELMRMCWQFNPKMRPSF 1519
>gb|M10051.1|HUMINSR Human insulin receptor mRNA, complete cds
          Length = 4723

 Score =  215 bits (548), Expect = 1e-53
 Identities = 116/284 (40%), Positives = 169/284 (58%), Gaps = 6/284 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++ TL R LG+G FG V E   +   +  +  +VAVK +         IE FL EA+
Sbjct: 3190 VSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIE-FLNEAS 3366

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL ++L + R     NP   P
Sbjct: 3367 VMKGFTCHHVVRLLGVVSKGQPT------LVVMELMAHGDLKSYLRSLRPEAENNPGRPP 3528

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3529 PTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3708

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W+A ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3709 RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 3888

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L QP  C E V DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 3889 DGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTF----LEIVNLL 4008
>ref|XM_048346.3| Homo sapiens insulin receptor (INSR), mRNA
          Length = 4479

 Score =  215 bits (548), Expect = 1e-53
 Identities = 116/284 (40%), Positives = 169/284 (58%), Gaps = 6/284 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++ TL R LG+G FG V E   +   +  +  +VAVK +         IE FL EA+
Sbjct: 2953 VSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIE-FLNEAS 3129

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL ++L + R     NP   P
Sbjct: 3130 VMKGFTCHHVVRLLGVVSKGQPT------LVVMELMAHGDLKSYLRSLRPEAENNPGRPP 3291

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3292 PTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3471

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W+A ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3472 RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 3651

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L QP  C E V DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 3652 DGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTF----LEIVNLL 3771
>ref|NM_052807.1| Rattus norvegicus Insulin-like growth factor 1 receptor (Igf1r), mRNA
          Length = 4696

 Score =  215 bits (548), Expect = 1e-53
 Identities = 114/282 (40%), Positives = 172/282 (60%), Gaps = 12/282 (4%)
 Frame = +1

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 3001 DVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 3177

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-- 609
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 3178 RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 3339

Query: 610  IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            +  N   +P  L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++
Sbjct: 3340 VENNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMT 3519

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R IY  DYYR+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ 
Sbjct: 3520 RDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLS 3699

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 3700 NEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 3825
>gb|L29232.1|RATIGFIRT Rattus norvegicus insulin-like growth factor I receptor mRNA,
            complete cds
          Length = 4696

 Score =  215 bits (548), Expect = 1e-53
 Identities = 114/282 (40%), Positives = 172/282 (60%), Gaps = 12/282 (4%)
 Frame = +1

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 3001 DVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 3177

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-- 609
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 3178 RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 3339

Query: 610  IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            +  N   +P  L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++
Sbjct: 3340 VENNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMT 3519

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R IY  DYYR+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ 
Sbjct: 3520 RDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLS 3699

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 3700 NEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 3825
>ref|NM_000208.1| Homo sapiens insulin receptor (INSR), mRNA
          Length = 4691

 Score =  215 bits (548), Expect = 1e-53
 Identities = 116/284 (40%), Positives = 169/284 (58%), Gaps = 6/284 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++ TL R LG+G FG V E   +   +  +  +VAVK +         IE FL EA+
Sbjct: 3158 VSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIE-FLNEAS 3334

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL ++L + R     NP   P
Sbjct: 3335 VMKGFTCHHVVRLLGVVSKGQPT------LVVMELMAHGDLKSYLRSLRPEAENNPGRPP 3496

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3497 PTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3676

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W+A ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3677 RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 3856

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L QP  C E V DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 3857 DGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTF----LEIVNLL 3976
>emb|AJ224993.1|PMA224993 Psetta maxima mRNA for insulin-like growth factor 1 receptor
          Length = 5899

 Score =  215 bits (547), Expect = 2e-53
 Identities = 114/285 (40%), Positives = 172/285 (60%), Gaps = 10/285 (3%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++  L R LG+G FG V E   K   +D    +VA+K +         IE FL EA+
Sbjct: 3965 VAREKIALSRELGQGSFGMVYEGLAKGVVKDEPETRVAIKTVNESASMRERIE-FLNEAS 4141

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNL--- 617
             MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  E  ++    
Sbjct: 4142 VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPKEQQWSSLSL 4303

Query: 618  -PLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
             PL+ +++    IA GM YL++  F+HRDLAARNCM+A+D TV + DFG++R IY  DYY
Sbjct: 4304 PPLRKMLQMAGQIADGMAYLNANKFVHRDLAARNCMVADDFTVKIGDFGMTRDIYETDYY 4483

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 4484 RKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEISTLAEQPYQGLSNEQVVRFVM 4663

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF----TCLRMELE 777
             G  L++P  C + +++LM  CW  +PK RP+F    + L+ ELE
Sbjct: 4664 EGGLLEKPQNCPDMLFELMRMCWQFNPKMRPAFVEIISSLKDELE 4798
>gb|AF056187.1|AF056187 Mus musculus insulin-like growth factor I receptor mRNA, complete cds
          Length = 4500

 Score =  215 bits (547), Expect = 2e-53
 Identities = 114/283 (40%), Positives = 170/283 (59%), Gaps = 13/283 (4%)
 Frame = +1

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 2956 DVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 3132

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 3133 RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 3294

Query: 612  ENPFNL-----PLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGL 666
                NL      L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG+
Sbjct: 3295 VEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGM 3474

Query: 667  SRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGI 726
            +R IY  DYYR+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+
Sbjct: 3475 TRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGL 3654

Query: 727  ENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 3655 SNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 3783
>ref|NM_000875.2| Homo sapiens insulin-like growth factor 1 receptor (IGF1R), mRNA
          Length = 4989

 Score =  215 bits (547), Expect = 2e-53
 Identities = 114/282 (40%), Positives = 172/282 (60%), Gaps = 12/282 (4%)
 Frame = +1

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 2998 DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 3174

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-- 609
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 3175 RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 3336

Query: 610  IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            +  NP   P  L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++
Sbjct: 3337 MENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMT 3516

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R IY  DYYR+G    LPV+W++ ESL D ++T +SDVW+FGV +WEI T  + PY G+ 
Sbjct: 3517 RDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLS 3696

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 3697 NEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 3822
>emb|X04434.1|HSIGFIRR Human mRNA for insulin-like growth factor I receptor
          Length = 4989

 Score =  215 bits (547), Expect = 2e-53
 Identities = 114/282 (40%), Positives = 172/282 (60%), Gaps = 12/282 (4%)
 Frame = +1

Query: 500  DVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV +P++      + T+ R LG+G FG V E   K   +D    +VA+K +  +  +  +
Sbjct: 2998 DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVN-EAASMRE 3174

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-- 609
              EFL EA+ MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  
Sbjct: 3175 RIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPE 3336

Query: 610  IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
            +  NP   P  L  +++   +IA GM YL++  F+HRDLAARNCM+AED TV + DFG++
Sbjct: 3337 MENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMT 3516

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R IY  DYYR+G    LPV+W++ ESL D ++T +SDVW+FGV +WEI T  + PY G+ 
Sbjct: 3517 RDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLS 3696

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            N ++  +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 3697 NEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF 3822
>dbj|AB065096.1|AB065096 Paralichthys olivaceus fIR-1 mRNA for insulin receptor, complete cds
          Length = 5781

 Score =  214 bits (544), Expect = 4e-53
 Identities = 112/274 (40%), Positives = 163/274 (58%), Gaps = 7/274 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ T+ R LG+G FG V E   K   +     +VAVK +         IE FL EA+
Sbjct: 3989 VPREKITVLRELGQGSFGMVYEGIAKDIVKGDPDTRVAVKTVNESASLRERIE-FLNEAS 4165

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFL--LASRIGENPFNLP 618
             MK F   HV +L+GV  +++        +V++  M HGDL ++L  L      NP   P
Sbjct: 4166 VMKAFSCHHVVRLLGVVSKAQPT------LVVMELMTHGDLKSYLRNLRPDSENNPTGRP 4327

Query: 619  ---LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDY 675
               L+ +++   +IA GM YL+++  +HRDLAARNCM+AED TV + DFG++R IY  DY
Sbjct: 4328 PPTLKEMIQMAAEIADGMAYLNAKKHVHRDLAARNCMVAEDYTVKIGDFGMTRDIYETDY 4507

Query: 676  YRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYL 735
            YR+G    LPV+W+A ESL D ++T HSD W+FGV +WEI T  + PY G+ N ++  ++
Sbjct: 4508 YRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFV 4687

Query: 736  IGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            + G  L +P  C E +++LM  CW  +PK RP F
Sbjct: 4688 MDGGYLDRPENCPERMHNLMQMCWQYNPKMRPMF 4789
>gb|AF055980.1|AF055980 Xenopus laevis insulin-like growth factor-1 receptor precursor, mRNA,
            complete cds
          Length = 4867

 Score =  214 bits (544), Expect = 4e-53
 Identities = 111/273 (40%), Positives = 170/273 (61%), Gaps = 6/273 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ T+ R LG+G FG V E   K   +D +  KVA+K +  +  +  +  EFL EA+
Sbjct: 3075 VPREKITMNRELGQGSFGMVYEGIAKGVVKDEAETKVAIKTVN-EAASMRERIEFLNEAS 3251

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG-ENPFNLP- 618
             MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R   E+    P 
Sbjct: 3252 VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPDTESNSGQPT 3413

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              L+ +++   +IA GM YL++  F+HRDLAARNCM+ ED TV + DFG++R IY  DYY
Sbjct: 3414 PSLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVTEDFTVKIGDFGMTRDIYETDYY 3593

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T +SDVW+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 3594 RKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVM 3773

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             G  L++P  C + +++LM  CW  +PK RPSF
Sbjct: 3774 EGGLLEKPDNCPDMLFELMRMCWQFNPKMRPSF 3872
>emb|X02160.1|HSIRPR Human mRNA for insulin receptor precursor
          Length = 5180

 Score =  213 bits (543), Expect = 5e-53
 Identities = 115/284 (40%), Positives = 168/284 (58%), Gaps = 6/284 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++ TL R LG+G FG V E   +   +  +  +VAVK +         IE FL EA+
Sbjct: 3064 VSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIE-FLNEAS 3240

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL ++L + R     NP   P
Sbjct: 3241 VMKGFTCHHVVRLLGVVSKGQPT------LVVMELMAHGDLKSYLRSLRPEAENNPGRPP 3402

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3403 PTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3582

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W+A ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3583 RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 3762

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L QP  C E V DLM  CW  +P  RP+F    +E+ N+L
Sbjct: 3763 DGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTF----LEIVNLL 3882
>ref|NM_010568.1| Mus musculus insulin receptor (Insr), mRNA
          Length = 4167

 Score =  213 bits (543), Expect = 5e-53
 Identities = 115/284 (40%), Positives = 168/284 (58%), Gaps = 6/284 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ TL R LG+G FG V E   K   +  +  +VAVK +         IE FL EA+
Sbjct: 3070 VPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIE-FLNEAS 3246

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL + L + R     NP   P
Sbjct: 3247 VMKGFTCHHVVRLLGVVSKGQPM------LVVMELMAHGDLKSHLRSLRPDAENNPGRPP 3408

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3409 PTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3588

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3589 RKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 3768

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L  P  C E + DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 3769 DGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTF----LEIVNLL 3888
>gb|J05149.1|MUSINSR Mouse insulin receptor (IR) mRNA, complete cds
          Length = 4167

 Score =  213 bits (543), Expect = 5e-53
 Identities = 115/284 (40%), Positives = 168/284 (58%), Gaps = 6/284 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ TL R LG+G FG V E   K   +  +  +VAVK +         IE FL EA+
Sbjct: 3070 VPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIE-FLNEAS 3246

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL + L + R     NP   P
Sbjct: 3247 VMKGFTCHHVVRLLGVVSKGQPM------LVVMELMAHGDLKSHLRSLRPDAENNPGRPP 3408

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3409 PTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3588

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3589 RKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 3768

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L  P  C E + DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 3769 DGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTF----LEIVNLL 3888
>dbj|AB050625.1|AB050625 Cynops pyrrhogaster IGF-IR mRNA for insulin-like growth factor I
            receptor, complete cds
          Length = 4336

 Score =  213 bits (543), Expect = 5e-53
 Identities = 111/273 (40%), Positives = 166/273 (60%), Gaps = 6/273 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++ T+ R LG+G FG V E   K   +D    +VA+K +         IE FL EA+
Sbjct: 3077 VAREKITMNRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNESASMRERIE-FLNEAS 3253

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG--ENPFNLP 618
             MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R     +P   P
Sbjct: 3254 VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRTDAESHPGQSP 3415

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              L+ +++   +IA GM YL++  F+HRDLAARNCM+ ED TV + DFG++R IY  DYY
Sbjct: 3416 PTLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVTEDFTVKIGDFGMTRDIYETDYY 3595

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T HSDVW+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 3596 RKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGMTNEQVLRFVM 3775

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             G  L++P  C + +++LM  CW  +PK RPSF
Sbjct: 3776 EGGLLEKPDNCPDMLFELMRMCWQYNPKMRPSF 3874
>emb|Z27409.1|HSRTKEPH H.sapiens mRNA for receptor tyrosine kinase eph (partial)
          Length = 2398

 Score =  213 bits (541), Expect = 9e-53
 Identities = 188/646 (29%), Positives = 282/646 (43%), Gaps = 32/646 (4%)
 Frame = +1

Query: 175 PSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVA 234
           P  S     G T  T   CE+ + +  A      V    PP+AP N + +  S    S+ 
Sbjct: 37  PQQSTAESEGATICT---CESGHYR--APGEGPQVACTGPPSAPRNLSFSA-SGTQLSLR 198

Query: 235 WVPGAD-----------------GLAL----LHSCTVQVAHAPGEWEALAVVVPVPPFTC 273
           W P AD                 G A        C V V  +PG   A A+  P      
Sbjct: 199 WEPPADTGGRQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPG---ARALTTPAVH--- 360

Query: 274 LLRNLAPATNYSLRVRCANA---LGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG-LI 329
            +  L P  NY+  V   N    LG S +       + G A + +  +   ++ +   L 
Sbjct: 361 -VNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLE 537

Query: 330 LEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNA 389
           L W    P  PG      Y+L  + ++  + ++++E  R  LT+  P    I+RV     
Sbjct: 538 LTWAGSRPRSPGANLT--YELHVLNQDEERYQMVLE-PRVLLTELQPDTTYIVRVRMLTP 708

Query: 390 IGDGPWSQPLVVSSHDHAGRQGPPHSRT----SWVPVVLGVXXXXXXXXXXXXXXXRKRR 445
           +G GP+S        DH  R  PP SR       V V+ G+               R+ +
Sbjct: 709 LGPGPFSP-------DHEFRTSPPVSRGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQ 867

Query: 446 KETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVL-IP 504
           ++ +  Q                 A   +RE    ++  +D     D  +  L+    + 
Sbjct: 868 RQRQQRQR--------------DRATDVDREDKLWLKPYVDLQAYEDPAQGALDFTRELD 1005

Query: 505 EQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKE 564
                +  ++G+GEFG V    L+        VA+K LK D         FLREA  M +
Sbjct: 1006PAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLK-DTSPGGQWWNFLREATIMGQ 1182

Query: 565 FDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVR 624
           F HPH+  L GV  +     R PI M+I  FM++G L AFL      E    L    LV 
Sbjct: 1183FSHPHILHLEGVVTK-----RKPI-MIITEFMENGALDAFLR-----EREDQLVPGQLVA 1329

Query: 625 FMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKI--YSGDYYRQGCAS 682
            +  IA GM YLS+ N++HRDLAARN ++ +++   V+DFGL+R +  + G Y  QG   
Sbjct: 1330MLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQG--G 1503

Query: 683 KLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLK 742
           K+P++W A E++A  ++T  SDVW+FG+ MWE+++ G  PY  + N E+   +  G RL 
Sbjct: 1504KIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLP 1683

Query: 743 QPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
            P +C   +Y+LM  CW+ D  +RP F  L+  LE +L +   L T
Sbjct: 1684PPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRT 1821
>dbj|AB065097.1|AB065097 Paralichthys olivaceus fIR-2 mRNA for insulin receptor, complete cds
          Length = 5519

 Score =  213 bits (541), Expect = 9e-53
 Identities = 110/273 (40%), Positives = 163/273 (59%), Gaps = 6/273 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++  + R LG+G FG V E   K   +  S  +VAVK +         IE FL EA+
Sbjct: 4141 VAREKIAILRELGQGTFGMVYEGNAKDIIKGESETRVAVKTVNESASLRERIE-FLNEAS 4317

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL +FL + R     NP   P
Sbjct: 4318 VMKAFSCHHVVRLLGVVSKGQPT------LVVMELMTHGDLKSFLRSLRPDAENNPGRPP 4479

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              L+ +++   +IA GM YL+++ F+HRDLAARNCM+A D+TV + DFG++R IY  DYY
Sbjct: 4480 PTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVANDLTVKIGDFGMTRDIYETDYY 4659

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    L V+W+A ESL D ++T HSD W+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 4660 RKGGKGLLSVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVM 4839

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             G  L +P  C + +++LM  CW  +PK RP+F
Sbjct: 4840 DGGYLDRPDNCADRIHNLMQMCWQYNPKMRPAF 4938
>emb|AJ132556.1|XLA132556 Xenopus laevis mRNA for insulin receptor precursor
          Length = 4523

 Score =  212 bits (540), Expect = 1e-52
 Identities = 141/452 (31%), Positives = 227/452 (50%), Gaps = 12/452 (2%)
 Frame = +1

Query: 330  LEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLI------LR 383
            L+W+E  P+DP  G +  Y++ + +  G ++ +     +   TD   +  ++      ++
Sbjct: 2779 LKWQE--PKDPN-GLIVLYEVHYSRVGGIEEVITCVSQKQYNTDKGGKLRVLTPGNYSVK 2949

Query: 384  VCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRK 443
            + A++  G+G W++       DH      PHS    V ++ G                 +
Sbjct: 2950 IRATSLAGNGSWTEQAYFQVPDH------PHSNI--VKIITGPIIAVFLLLIVLVYCVVQ 3105

Query: 444  RRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLI 503
            ++K+           A G       A   +    PE + A+   + I DE +       +
Sbjct: 3106 KKKD-----------AEGP------AGPLYTSSNPEYLSAS--EVYIPDEWE-------V 3207

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAAC 561
            P  +  L R LG+G FG V E   K   +    V+VAVK +         IE FL EA+ 
Sbjct: 3208 PRDKINLLRELGQGSFGMVYEGIAKDIIKGEPEVRVAVKTVNESASLRERIE-FLNEASV 3384

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP- 618
            MK F+  HV +L+GV  + +        +VI+  M HGDL ++L + R     NP  L  
Sbjct: 3385 MKAFNCHHVVRLLGVVSKGQPT------LVIMELMAHGDLKSYLRSLRPDAENNPGRLAP 3546

Query: 619  -LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L+ +++   +I+ GM YL+++ F+HRDLAARNCM+A+D  V + DFG++R IY  DYYR
Sbjct: 3547 TLKEIIQMAAEISDGMAYLNAKKFVHRDLAARNCMVADDYAVKIGDFGMTRDIYETDYYR 3726

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W++ ESL D ++T  SDVW+FGV +WEI +  + PY G+ N ++  +++ 
Sbjct: 3727 KGGKGLLPVRWMSPESLKDGVFTAFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMD 3906

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            G  L  P  C   ++ LM  CW  +PK RP+F
Sbjct: 3907 GGSLDHPENCPPRLHSLMQMCWQYNPKMRPTF 4002
>ref|NM_017071.1| Rattus norvegicus Insulin receptor (Insr), mRNA
          Length = 5397

 Score =  212 bits (540), Expect = 1e-52
 Identities = 116/284 (40%), Positives = 167/284 (57%), Gaps = 6/284 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFV--KVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ TL R LG+G FG V E   K      V  +VAVK +         IE FL EA+
Sbjct: 3402 VPREKITLLRELGQGSFGMVYEGNAKDIIKGEVETRVAVKTVNESASLRERIE-FLNEAS 3578

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL + L + R     NP   P
Sbjct: 3579 VMKGFTCHHVVRLLGVVSKGQPT------LVVMELMAHGDLKSHLRSLRPDAENNPGRPP 3740

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3741 PTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3920

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3921 RKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 4100

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L  P  C E + DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 4101 DGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTF----LEIVNLL 4220
>gb|M29014.1|RATINSAB Rat insulin receptor mRNA, complete cds
          Length = 5397

 Score =  212 bits (540), Expect = 1e-52
 Identities = 116/284 (40%), Positives = 167/284 (57%), Gaps = 6/284 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFV--KVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ TL R LG+G FG V E   K      V  +VAVK +         IE FL EA+
Sbjct: 3402 VPREKITLLRELGQGSFGMVYEGNAKDIIKGEVETRVAVKTVNESASLRERIE-FLNEAS 3578

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFNLP 618
             MK F   HV +L+GV  + +        +V++  M HGDL + L + R     NP   P
Sbjct: 3579 VMKGFTCHHVVRLLGVVSKGQPT------LVVMELMAHGDLKSHLRSLRPDAENNPGRPP 3740

Query: 619  --LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
              LQ +++   +IA GM YL+++ F+HRDLAARNCM+A D TV + DFG++R IY  DYY
Sbjct: 3741 PTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY 3920

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T  SD+W+FGV +WEI +  + PY G+ N ++  +++
Sbjct: 3921 RKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM 4100

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G  L  P  C E + DLM  CW  +PK RP+F    +E+ N+L
Sbjct: 4101 DGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTF----LEIVNLL 4220
>dbj|AB065099.1|AB065099 Paralichthys olivaceus fIGF-IR-2 mRNA for type 1 insulin-like growth
            factor receptor, complete cds
          Length = 5367

 Score =  212 bits (539), Expect = 2e-52
 Identities = 114/285 (40%), Positives = 171/285 (60%), Gaps = 10/285 (3%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +  ++  L R LG+G FG V E   K   +D    +VA+K +         IE FL EA+
Sbjct: 3781 VVREKIVLSRELGQGSFGMVYEGLAKGVVKDEPETRVAIKTVNESASMRERIE-FLNEAS 3957

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNL--- 617
             MKEF+  HV +L+GV  + +        +VI+  M  GDL ++L + R  E  ++    
Sbjct: 3958 VMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPKEQQWSSLSL 4119

Query: 618  -PLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
             PL+ +++    IA GM YL++  F+HRDLAARNCM+AED  V + DFG++R IY  DYY
Sbjct: 4120 PPLKKMLQMAGQIADGMAYLNANKFVHRDLAARNCMVAEDFIVKIGDFGMTRDIYETDYY 4299

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G    LPV+W++ ESL D ++T +SDVW+FGV +WEI T  + PY G+ N ++  +++
Sbjct: 4300 RKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEISTLAEQPYQGLSNEQVLRFVM 4479

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF----TCLRMELE 777
             G  L++P  C + +++LM  CW  +PK RPSF    + L+ ELE
Sbjct: 4480 EGGLLEKPQNCPDMLFELMRMCWQYNPKMRPSFVEIISSLKDELE 4614
>gb|U15443.1|MMU15443 Mus musculus proto-oncogene protein c-ros (c-ros) mRNA, complete cds
          Length = 7407

 Score =  211 bits (538), Expect = 2e-52
 Identities = 161/541 (29%), Positives = 265/541 (48%), Gaps = 32/541 (5%)
 Frame = +3

Query: 269  PPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGL 328
            P + C + +L P T+Y++RV      G +       F+TK   P++       +   S  
Sbjct: 5394 PVYVCNITDLQPYTSYNIRVVVVYTTGENSSSIPESFKTKAGVPSKP--GIPKLLEGSKN 5567

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSW-------VQENGTQDELMVEGTRANLTDWDPQK--- 378
             ++WE+   ED G   L  Y L          Q   ++ +++  G+ +++  W  +    
Sbjct: 5568 SIQWEKA--EDNGSR-LMYYSLEVRKGISNDSQNQSSRWKVVFNGSCSSICTWRSKNLKG 5738

Query: 379  DLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV-PVVLGVXXXXXXXXXXX 437
                R  A+N IG G +S+   +S        G   + TS++  +++G+           
Sbjct: 5739 TFQFRAVAANEIGLGEYSE---ISEDITLVEDGVWITETSFILTIIVGIFLVATVPLTFV 5909

Query: 438  XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL--- 494
                 K  K ++ G +                  S N +    +      +G+++     
Sbjct: 5910 WHRSLKSHKASKEGLS----------------VLSDNDKELAELRGLAAGVGLANACYGI 6041

Query: 495  -----KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKAD 545
                 +E++E++   P ++ +L  +LG G FG V E     +       +KVAVK LK  
Sbjct: 6042 HTVPTQEEIENLPAFPREKLSLRLLLGSGAFGEVYEGTAIDILGVGSGEIKVAVKTLKK- 6218

Query: 546  IIASSDIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHA 603
               S+D E  EFL+EA  M +F+HP++ K +GV L    +       +IL  M+ GDL +
Sbjct: 6219 --GSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLGEPQ------YIILELMEGGDLLS 6374

Query: 604  FLLASR--IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT-- 658
            +L  +R      P +L L  LV   VDI+ G  YL   +FIHRDLAARNC+++ +D T  
Sbjct: 6375 YLRKARGTTFHGP-SLTLLDLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTNP 6551

Query: 659  --VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIM 716
              V + DFGL+R+IY  DYYR+     LP +W+A E+L D ++T  SDVW+FG+ +WEI+
Sbjct: 6552 RVVKIGDFGLAREIYKNDYYRKRGEGLLPARWMAPENLMDGIFTSQSDVWSFGILVWEIL 6731

Query: 717  TRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
            T G  PY    N ++ NY+  G RL+ P  C +++++LM QCW+ +P QRP+F  ++ +L
Sbjct: 6732 TLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMSQCWAQEPDQRPTFHNIQNQL 6911

Query: 777  E 777
            +
Sbjct: 6912 Q 6914
>emb|X15786.1|HSRETTT Human ret-II gene
          Length = 2872

 Score =  211 bits (538), Expect = 2e-52
 Identities = 128/356 (35%), Positives = 190/356 (52%), Gaps = 21/356 (5%)
 Frame = +2

Query: 446  KETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPE 505
            KE    +  DS  A        R  +   RE  +++   +  L    +   K E    P 
Sbjct: 1427 KEGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIHQLRSELQEDPKWE---FPR 1597

Query: 506  QQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACM 562
            +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E   +
Sbjct: 1598 KNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFNVL 1771

Query: 563  KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN----- 616
            K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G          
Sbjct: 1772 KQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSR 1933

Query: 617  ------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADF 664
                        L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DF
Sbjct: 1934 NSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDF 2113

Query: 665  GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
            GLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  PY 
Sbjct: 2114 GLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYP 2293

Query: 725  GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 2294 GIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 2461
>emb|AJ222795.1|XLMUSK Xenopus laevis mRNA for muscle specific kinase, TK domain
          Length = 1230

 Score =  211 bits (538), Expect = 2e-52
 Identities = 129/310 (41%), Positives = 172/310 (54%), Gaps = 24/310 (7%)
 Frame = +1

Query: 494 LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
           L  KL  +  P       R +G G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 136 LNHKLLSLEYPRNNIEYVRDIGAGAFGRVFQARAPGLLSYEP--FTMVAVKMLKEE--AS 303

Query: 550 SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
           +D+  +F REAA M EFDHP++ KL+GV     A G+   PM +L  +M HGDL+ +L  
Sbjct: 304 ADMHADFQREAALMAEFDHPNIVKLLGVC----AVGK---PMCLLFEYMAHGDLNEYLRH 462

Query: 606 -------------LASRI---GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAAR 649
                        LA+++     NP  L     +     +A GM YLS R F+HRDLA R
Sbjct: 463 RSPRALSSLSHSSLAAKVRLCDLNPSPLSCTDQLCIAQQVAAGMAYLSERKFVHRDLATR 642

Query: 650 NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
           NC++ E+  V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 643 NCLVGENAVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYG 822

Query: 710 VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
           V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 823 VVLWEIFSYGMQPYYGMAHEEVIYYVRDGNILSCPENCPLELYNLMRLCWSKMPSDRPSF 1002

Query: 770 TCLRMELENI 779
            C+   LE +
Sbjct: 1003ACIYRILERM 1032
>emb|X81650.1|MMCROSP M.musculus mRNA for c-ros protooncogene
          Length = 7288

 Score =  211 bits (538), Expect = 2e-52
 Identities = 161/541 (29%), Positives = 266/541 (48%), Gaps = 32/541 (5%)
 Frame = +1

Query: 269  PPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGL 328
            P + C + +L P T+Y++RV      G +       F+TK   P++       +   S  
Sbjct: 5218 PVYVCNITDLQPYTSYNIRVVVVYTTGENSSSIPESFKTKAGVPSKP--GIPKLLEGSKN 5391

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSW-------VQENGTQDELMVEGTRANLTDWDPQK--- 378
             ++WE+   ED G   L  Y L          Q   ++ +++  G+ +++  W  +    
Sbjct: 5392 SIQWEKA--EDNGSR-LMYYTLEVRKGISNDSQNQSSRWKVVFNGSCSSICTWRSKNLKG 5562

Query: 379  DLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV-PVVLGVXXXXXXXXXXX 437
                R  A+N IG G +S+   +S        G   + TS++  +++G+           
Sbjct: 5563 TFQFRAVAANEIGLGEYSE---ISEDITLVEDGVWITETSFILTIIVGIFLVATVPLTFV 5733

Query: 438  XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL--- 494
                 K  K ++ G +                  + N +    +      +G+++     
Sbjct: 5734 WHRSLKSHKASKEGLS----------------VLNDNDKELAELRGLAAGVGLANACYAV 5865

Query: 495  -----KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKAD 545
                 +E++E++   P ++ +L  +LG G FG V E     +       +KVAVK LK  
Sbjct: 5866 HTVPTQEEIENLPAFPREKLSLRLLLGSGAFGEVYEGTAIDILGVGSGEIKVAVKTLKK- 6042

Query: 546  IIASSDIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHA 603
               S+D E  EFL+EA  M +F+HP++ K +GV L    +       +IL  M+ GDL +
Sbjct: 6043 --GSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLGEPQ------YIILELMEGGDLLS 6198

Query: 604  FLLASR--IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT-- 658
            +L  +R      P +L L  LV   VDI+ G  YL   +FIHRDLAARNC+++ +D T  
Sbjct: 6199 YLRKARGTTFHGP-SLTLLDLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSP 6375

Query: 659  --VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIM 716
              V + DFGL+R+IY  DYYR+     LPV+W+A E+L D ++T  SDVW+FG+ +WEI+
Sbjct: 6376 RVVKIGDFGLAREIYKNDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEIL 6555

Query: 717  TRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
            T G  PY    N ++ NY+  G RL+ P  C +++++LM QCW+ +P QRP+F  ++ +L
Sbjct: 6556 TLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMSQCWAQEPDQRPTFHNIQNQL 6735

Query: 777  E 777
            +
Sbjct: 6736 Q 6738
>ref|XM_056982.1| Homo sapiens EphA1 (EPHA1), mRNA
          Length = 3340

 Score =  211 bits (537), Expect = 3e-52
 Identities = 187/646 (28%), Positives = 279/646 (42%), Gaps = 32/646 (4%)
 Frame = +1

Query: 175  PSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVA 234
            P  S     G T  T   CE+ + +  A      V    PP+AP N + +  S    S+ 
Sbjct: 979  PQQSTAESEGATICT---CESGHYR--APGEGPQVACTGPPSAPRNLSFSA-SGTQLSLR 1140

Query: 235  WVPGAD-----------------GLAL----LHSCTVQVAHAPGEWEALAVVVPVPPFTC 273
            W P AD                 G A        C V V  +PG        V V     
Sbjct: 1141 WEPPADTGGRQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHV----- 1305

Query: 274  LLRNLAPATNYSLRVRCANA---LGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG-LI 329
                L P  NY+  V   N    LG S +       + G A + +  +   ++ +   L 
Sbjct: 1306 --NGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLE 1479

Query: 330  LEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNA 389
            L W    P  PG      Y+L  + ++  + ++++E  R  LT+  P    I+RV     
Sbjct: 1480 LTWAGSRPRSPGANLT--YELHVLNQDEERYQMVLE-PRVLLTELQPDTTYIVRVRMLTP 1650

Query: 390  IGDGPWSQPLVVSSHDHAGRQGPPHSRT----SWVPVVLGVXXXXXXXXXXXXXXXRKRR 445
            +G GP+S        DH  R  PP SR       V V+ G+               R+ +
Sbjct: 1651 LGPGPFSP-------DHEFRTSPPVSRGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQ 1809

Query: 446  KETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVL-IP 504
            ++ +  Q                 A   +RE    ++  +D     D  +  L+    + 
Sbjct: 1810 RQRQQRQR--------------DRATDVDREDKLWLKPYVDLQAYEDPAQGALDFTRELD 1947

Query: 505  EQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKE 564
                 +  ++G+GEFG V    L+        VA+K LK D         FLREA  M +
Sbjct: 1948 PAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLK-DTSPGGQWWNFLREATIMGQ 2124

Query: 565  FDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVR 624
            F HPH+  L GV  +     R PI M+I  FM++G L AFL      E    L    LV 
Sbjct: 2125 FSHPHILHLEGVVTK-----RKPI-MIITEFMENGALDAFLR-----EREDQLVPGQLVA 2271

Query: 625  FMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKI--YSGDYYRQGCAS 682
             +  IA GM YLS+ N++HRDLAARN ++ +++   V+DFGL+R +  + G Y  QG   
Sbjct: 2272 MLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQG--G 2445

Query: 683  KLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLK 742
            K+P++W A E++A  ++T  SDVW+FG+ MWE+++ G  PY  + N E+   +  G RL 
Sbjct: 2446 KIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLP 2625

Query: 743  QPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
             P +C   +Y+LM  CW+ D  +RP F  L+  LE +L +   L T
Sbjct: 2626 PPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRT 2763
>gb|AY058497.1| Drosophila melanogaster LD03455 full length cDNA
          Length = 5105

 Score =  211 bits (537), Expect = 3e-52
 Identities = 124/296 (41%), Positives = 168/296 (55%), Gaps = 2/296 (0%)
 Frame = +1

Query: 514  LGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKL 573
            LG G++G V EA  K+   +   VAVK LK D +A   +++FL EAA MKE  HP++ +L
Sbjct: 949  LGGGQYGEVYEAVWKRYGNT---VAVKTLKEDTMA---LKDFLEEAAIMKEMKHPNLVQL 1110

Query: 574  VGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGM 633
            +GV  R       P   +I  FM HG+L  FL ++        L    L+     IA GM
Sbjct: 1111 IGVCTRE------PPFYIITEFMSHGNLLDFLRSA----GRETLDAVALLYMATQIASGM 1260

Query: 634  EYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALES 693
             YL SRN+IHRDLAARNC++ ++  V VADFGL+R +   D Y     +K P+KW A E 
Sbjct: 1261 SYLESRNYIHRDLAARNCLVGDNKLVKVADFGLAR-LMRDDTYTAHAGAKFPIKWTAPEG 1437

Query: 694  LADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYD 753
            LA N ++  SDVWAFGV +WEI T G +PY  I+  ++Y+ L  G R+++PP C  EVYD
Sbjct: 1438 LAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYD 1617

Query: 754  LMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQ--PTESG 807
            LM QCW  D   RP+F  +   LE++    S+    +  L  N   A    P+ SG
Sbjct: 1618 LMRQCWQWDATDRPTFKSIHHALEHMFQESSITEAVEKQLNANATSASSSAPSTSG 1785
>ref|NM_080104.1| Drosophila melanogaster Abl oncogene (Abl), mRNA
          Length = 4515

 Score =  211 bits (537), Expect = 3e-52
 Identities = 124/296 (41%), Positives = 168/296 (55%), Gaps = 2/296 (0%)
 Frame = +1

Query: 514  LGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKL 573
            LG G++G V EA  K+   +   VAVK LK D +A   +++FL EAA MKE  HP++ +L
Sbjct: 1129 LGGGQYGEVYEAVWKRYGNT---VAVKTLKEDTMA---LKDFLEEAAIMKEMKHPNLVQL 1290

Query: 574  VGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGM 633
            +GV  R       P   +I  FM HG+L  FL ++        L    L+     IA GM
Sbjct: 1291 IGVCTRE------PPFYIITEFMSHGNLLDFLRSA----GRETLDAVALLYMATQIASGM 1440

Query: 634  EYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALES 693
             YL SRN+IHRDLAARNC++ ++  V VADFGL+R +   D Y     +K P+KW A E 
Sbjct: 1441 SYLESRNYIHRDLAARNCLVGDNKLVKVADFGLAR-LMRDDTYTAHAGAKFPIKWTAPEG 1617

Query: 694  LADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYD 753
            LA N ++  SDVWAFGV +WEI T G +PY  I+  ++Y+ L  G R+++PP C  EVYD
Sbjct: 1618 LAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYD 1797

Query: 754  LMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQ--PTESG 807
            LM QCW  D   RP+F  +   LE++    S+    +  L  N   A    P+ SG
Sbjct: 1798 LMRQCWQWDATDRPTFKSIHHALEHMFQESSITEAVEKQLNANATSASSSAPSTSG 1965
>gb|AF209436.1|AF209436 Mus musculus c-ret proto-oncogene mRNA, complete cds
          Length = 3348

 Score =  210 bits (535), Expect = 4e-52
 Identities = 129/344 (37%), Positives = 195/344 (56%), Gaps = 26/344 (7%)
 Frame = +1

Query: 463  PAVHFRAARSFNRERPERIEAT-----LDSLGISDELKEKLEDVLIPEQQFTLGRMLGKG 517
            PA  F  + S +  R   +++T     +DS  I ++ K +      P +   LG+ LG+G
Sbjct: 2038 PAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIPEDPKWEF-----PRKNLVLGKTLGEG 2202

Query: 518  EFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            EFG V +A   +LK   G +  VAVKMLK +  + S++ + L E   +K+ +HPHV KL 
Sbjct: 2203 EFGKVVKATAFRLKGRAG-YTTVAVKMLKENA-SQSELRDLLSEFNLLKQVNHPHVIKLY 2376

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IG---------------ENPFN-- 616
            G   +    G L   ++I+ + K+G L  FL  SR IG               ++P    
Sbjct: 2377 GACSQD---GPL---LLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLDHPDERV 2538

Query: 617  LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DFGLSR +Y  D Y
Sbjct: 2539 LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSY 2718

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
             +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  PY GI    ++N L 
Sbjct: 2719 VKKSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLK 2898

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 2899 TGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3030
>emb|Z49898.1|GDRETMRNA G.domesticus mRNA for ret protein
          Length = 3342

 Score =  210 bits (535), Expect = 4e-52
 Identities = 119/298 (39%), Positives = 177/298 (58%), Gaps = 21/298 (7%)
 Frame = +2

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A   +LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2162 PRKNLVLGKTLGEGEFGKVVKATAFRLKGRAG-YTTVAVKMLKENA-SQSELRDLLSEFN 2335

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR------IG--- 611
             +K+ +HPHV KL G   +    G L    +I+ + K+G L +FL  SR      +G   
Sbjct: 2336 LLKQVNHPHVIKLYGACSQD---GPL---YLIVEYAKYGSLRSFLRESRKVGPSYVGSDG 2497

Query: 612  -------ENPFN--LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                   +NP    L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2498 NRNSSYLDNPDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKIS 2677

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2678 DFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 2857

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G R+++P  C EE+Y+LM +CW  +P +RP+F  +  ELE ++
Sbjct: 2858 YPGIAPERLFNLLKTGYRMERPENCSEEMYNLMLRCWKQEPDKRPTFAEISKELEKMM 3031
>dbj|AB006563.3|AB006563 Ephydatia fluviatilis EfPTK28 mRNA for protein tyrosine kinase,
            complete cds
          Length = 1891

 Score =  210 bits (534), Expect = 6e-52
 Identities = 113/275 (41%), Positives = 163/275 (59%), Gaps = 5/275 (1%)
 Frame = +3

Query: 513  MLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAK 572
            + G+G F  V    L Q      +VAVK +K+ I + ++++ F  E + M+   HP+V  
Sbjct: 945  VFGEGSFSKVYRGTLHQMGTGTTEVAVKAMKS-IESDAEMKSFFTECSVMQTLKHPNVLG 1121

Query: 573  LVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-----IGENPFNLPLQTLVRFMV 627
            ++G+   S       IP+++LPFM +G+L  +L   R     +   P NL LQ L R  V
Sbjct: 1122 ILGMCFDSPDS----IPLMVLPFMVNGNLKDYLKKHRGPHLQLETYPENLSLQMLKRICV 1289

Query: 628  DIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVK 687
            DI  GM YL+ R F+HRDLAARNC+L   + V V DFGL+R IY  +YYR    +KLPVK
Sbjct: 1290 DITRGMSYLADRRFVHRDLAARNCLLDSALAVKVGDFGLTRDIYLTNYYRAPTETKLPVK 1469

Query: 688  WLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPEC 747
            W+  E L D +    +DVW+FGVT WE+ + G TPY G++N  +  +L+ G RL++P  C
Sbjct: 1470 WMPPEMLQDGVSDEKTDVWSFGVTCWEVFSFGSTPYPGVDNHLMLQHLMSGLRLQKPLLC 1649

Query: 748  MEEVYDLMYQCWSADPKQRPSFTCLRMELENILGH 782
             +E+Y LM +CWS++P+ RP+F  L  E   I  H
Sbjct: 1650 PDEIYTLMARCWSSNPEDRPTFNELFKEFSAI*KH 1754
>dbj|AB065098.1|AB065098 Paralichthys olivaceus fIGF-IR-1 mRNA for type 1 insulin-like growth
            factor receptor, complete cds
          Length = 5150

 Score =  209 bits (532), Expect = 1e-51
 Identities = 112/293 (38%), Positives = 174/293 (59%), Gaps = 8/293 (2%)
 Frame = +3

Query: 507  QFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAACMKE 564
            + T+ + LG+G FG V E   K   +D    +VA+K +         IE FL EA+ MKE
Sbjct: 3612 KITMHKELGQGSFGMVYEGLAKGVVKDEPETRVAIKTVNESASMRERIE-FLNEASVMKE 3788

Query: 565  FDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNL--PLQTL 622
            F+  HV +L+GV  + +        +VI+  M  GDL + L + R   +   +  PL+ +
Sbjct: 3789 FNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSHLRSLRKENSTTQVLPPLKKM 3950

Query: 623  VRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCAS 682
            ++   +IA GM YL++  F+HRDLAARNCM+AED  V + DFG++R IY  DYYR+G   
Sbjct: 3951 IQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFAVKIGDFGMTRDIYETDYYRKGGKG 4130

Query: 683  KLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLK 742
             LPV+W++ ESL D ++T  SDVW+FGV +WEI T  + PY G+ N ++  +++ G  L 
Sbjct: 4131 LLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLD 4310

Query: 743  QPPECMEEVYDLMYQCWSADPKQRPSF----TCLRMELENILGHLSVLSTSQD 791
            +P  C + +++LM  CW  +PK RPSF    + ++ EL++  G +S   + ++
Sbjct: 4311 KPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKDELDSPFGEMSFFYSEEN 4469
>ref|NM_005157.2| Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 1
            (ABL1), transcript variant a, mRNA
          Length = 5744

 Score =  209 bits (531), Expect = 1e-51
 Identities = 123/303 (40%), Positives = 170/303 (55%)
 Frame = +2

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 1091 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 1252

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 1253 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVNAVVLLYMATQ 1402

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1403 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1579

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+K+P  C 
Sbjct: 1580 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDRSQVYELLEKDYRMKRPEGCP 1759

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGS 808
            E+VY+LM  CW  +P  RPSF  +    E +    S+    +  L     R    T   +
Sbjct: 1760 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVTTLLQA 1939

Query: 809  PEL 811
            PEL
Sbjct: 1940 PEL 1948
>gb|M31213.1|HUMPTCAA Human papillary thyroid carcinoma-encoded protein mRNA, complete
           cds
          Length = 3642

 Score =  209 bits (531), Expect = 1e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504 PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
           P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 376 PRKNLVLGKTLGEGEFGKVVKATAFHLKGR-GGYTTVAVKMLKENA-SPSELRDLLSEFN 549

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
            +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 550 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 711

Query: 617 --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                         L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 712 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 891

Query: 663 DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
           DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 892 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 1071

Query: 723 YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 1072YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 1245
>gb|M14752.1|HUMABLA Human c-abl gene, complete cds
          Length = 3840

 Score =  209 bits (531), Expect = 1e-51
 Identities = 123/303 (40%), Positives = 170/303 (55%)
 Frame = +2

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 1091 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 1252

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 1253 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVNAVVLLYMATQ 1402

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1403 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1579

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+K+P  C 
Sbjct: 1580 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDRSQVYELLEKDYRMKRPEGCP 1759

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGS 808
            E+VY+LM  CW  +P  RPSF  +    E +    S+    +  L     R    T   +
Sbjct: 1760 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVTTLLQA 1939

Query: 809  PEL 811
            PEL
Sbjct: 1940 PEL 1948
>gb|AF062497.1|AF062497 Oncorhynchus mykiss insulin receptor b (IRb) mRNA, partial cds
          Length = 1431

 Score =  209 bits (531), Expect = 1e-51
 Identities = 112/278 (40%), Positives = 162/278 (57%), Gaps = 7/278 (2%)
 Frame = +1

Query: 499 EDVLIPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFL 556
           +D  +   +  + R LG+G FG V E   K   +      VAVK +         IE FL
Sbjct: 244 DDWEVGRDKINILRELGQGSFGMVYEGIAKDIVKGEPETHVAVKTVNESASLRERIE-FL 420

Query: 557 REAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGE--NP 614
            EA+ MK F   HV +L+GV  + +        +V++  M HGDL ++L   R     NP
Sbjct: 421 NEASVMKGFTCHHVVRLMGVVSKGQPT------LVVMELMTHGDLKSYLRCLRPDSENNP 582

Query: 615 FNLP---LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY 671
              P   L+ +V+   +IA GM YL+++ F+HRDLAARNCM+A+D TV + DFG++R IY
Sbjct: 583 TGSPPPTLREMVQMTAEIADGMAYLNAKKFVHRDLAARNCMVAQDFTVKIGDFGMTRDIY 762

Query: 672 SGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEI 731
             DYYR+G    LPV+W+A ESL D ++T HSD W+FGV +WEI T  + PY G+ N ++
Sbjct: 763 ETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQV 942

Query: 732 YNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             +++ G  L +P  C + +++LM  CW  +PK RPSF
Sbjct: 943 LKFVMDGGYLDRPDNCADRLHNLMSMCWQYNPKLRPSF 1056
>ref|NM_007313.1| Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 1
            (ABL1), transcript variant b, mRNA
          Length = 5434

 Score =  209 bits (531), Expect = 1e-51
 Identities = 123/303 (40%), Positives = 170/303 (55%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 781  TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 942

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 943  NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVNAVVLLYMATQ 1092

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1093 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1269

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+K+P  C 
Sbjct: 1270 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDRSQVYELLEKDYRMKRPEGCP 1449

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGS 808
            E+VY+LM  CW  +P  RPSF  +    E +    S+    +  L     R    T   +
Sbjct: 1450 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVTTLLQA 1629

Query: 809  PEL 811
            PEL
Sbjct: 1630 PEL 1638
>ref|NM_078559.1| Drosophila melanogaster sevenless (sev), mRNA
          Length = 8758

 Score =  208 bits (530), Expect = 2e-51
 Identities = 118/284 (41%), Positives = 160/284 (55%), Gaps = 16/284 (5%)
 Frame = +1

Query: 502  LIPE---QQFTLGRMLGKGEFGSVREAQLKQEDGSFV-KVAVKMLKADIIASSDIEEFLR 557
            L+P+    Q  L R LG G FG V E QLK ED     +VA+K L+     +S+  E L+
Sbjct: 7411 LLPQINWSQLKLLRFLGSGAFGEVYEGQLKTEDSEEPQRVAIKSLRK---GASEFAELLQ 7581

Query: 558  EAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP--- 614
            EA  M  F H ++  LVG+   + +        +I+  M+ GDL ++L A+R        
Sbjct: 7582 EAQLMSNFKHENIVCLVGICFDTESIS------LIMEHMEAGDLLSYLRAARATSTQEPQ 7743

Query: 615  --FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDM-------TVCVADFG 665
                L L  L+   +D+A G  YL   +F+HRDLA RNC++ E         TV + DFG
Sbjct: 7744 PTAGLSLSELLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIGDFG 7923

Query: 666  LSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
            L+R IY  DYYR+     LPV+W++ ESL D L+T  SDVWAFGV  WEI+T GQ PYA 
Sbjct: 7924 LARDIYKSDYYRKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAA 8103

Query: 726  IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
              N E+  ++  G RL+QPP C E++Y L+  CW  DP +RPSF
Sbjct: 8104 RNNFEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSF 8235
>emb|X13666.1|DMSEVL2 Drosophila melanogaster mRNA for sevenless protein (sev gene)
          Length = 8758

 Score =  208 bits (530), Expect = 2e-51
 Identities = 118/284 (41%), Positives = 160/284 (55%), Gaps = 16/284 (5%)
 Frame = +1

Query: 502  LIPE---QQFTLGRMLGKGEFGSVREAQLKQEDGSFV-KVAVKMLKADIIASSDIEEFLR 557
            L+P+    Q  L R LG G FG V E QLK ED     +VA+K L+     +S+  E L+
Sbjct: 7411 LLPQINWSQLKLLRFLGSGAFGEVYEGQLKTEDSEEPQRVAIKSLRK---GASEFAELLQ 7581

Query: 558  EAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP--- 614
            EA  M  F H ++  LVG+   + +        +I+  M+ GDL ++L A+R        
Sbjct: 7582 EAQLMSNFKHENIVCLVGICFDTESIS------LIMEHMEAGDLLSYLRAARATSTQEPQ 7743

Query: 615  --FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDM-------TVCVADFG 665
                L L  L+   +D+A G  YL   +F+HRDLA RNC++ E         TV + DFG
Sbjct: 7744 PTAGLSLSELLAMCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDRRRTVKIGDFG 7923

Query: 666  LSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
            L+R IY  DYYR+     LPV+W++ ESL D L+T  SDVWAFGV  WEI+T GQ PYA 
Sbjct: 7924 LARDIYKSDYYRKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAA 8103

Query: 726  IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
              N E+  ++  G RL+QPP C E++Y L+  CW  DP +RPSF
Sbjct: 8104 RNNFEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSF 8235
>ref|NM_005232.1| Homo sapiens EphA1 (EPHA1), mRNA
          Length = 3370

 Score =  208 bits (530), Expect = 2e-51
 Identities = 194/651 (29%), Positives = 287/651 (43%), Gaps = 37/651 (5%)
 Frame = +1

Query: 175  PSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVA 234
            P  S     G T  T   CE+ + +  A      V    PP+AP N + +  S    S+ 
Sbjct: 985  PQQSTAESEGATICT---CESGHYR--APGEGPQVACTGPPSAPRNLSFSA-SGTQLSLR 1146

Query: 235  WVPGAD-----------------GLAL----LHSCTVQVAHAPGEWEALAVVVPVPPFTC 273
            W P AD                 G A        C V V  +PG   A A+  P      
Sbjct: 1147 WEPPADTGGRQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPG---ARALTTPAVH--- 1308

Query: 274  LLRNLAPATNYSLRVRCANA---LGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG-LI 329
             +  L P  NY+  V   N    LG S +       + G A + +  +   ++ +   L 
Sbjct: 1309 -VNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLE 1485

Query: 330  LEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNA 389
            L W    P  PG      Y+L  + ++  + ++++E  R  LT+  P    I+RV     
Sbjct: 1486 LTWAGSRPRSPGANLT--YELHVLNQDEERYQMVLE-PRVLLTELQPDTTYIVRVRMLTP 1656

Query: 390  IGDGPWSQPLVVSSHDHAGRQGPPHSRT----SWVPVVLGVXXXXXXXXXXXXXXXRK-- 443
            +G GP+S        DH  R  PP SR       V V+ G+               R+  
Sbjct: 1657 LGPGPFSP-------DHEFRTSPPVSRGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQ 1815

Query: 444  RRKETRFGQAFDSVMARGEPAVHF----RAARSFNRERPERIEATLDSLGISDELKEKLE 499
            R+++ R   A    + R   A       R  R+ +RE       TL   G S+    +L+
Sbjct: 1816 RQRQQRHVTAPPMWIERTSCAEALCGTSRHTRTLHRE-----PWTLPG-GWSNFPSRELD 1977

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
               +      +  ++G+GEFG V    L+        VA+K LK D         FLREA
Sbjct: 1978 PAWL-----MVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLK-DTSPGGQWWNFLREA 2139

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M +F HPH+  L GV  +     R PI M+I  FM++  L AFL      E    L  
Sbjct: 2140 TIMGQFSHPHILHLEGVVTK-----RKPI-MIITEFMENAALDAFLR-----EREDQLVP 2286

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKI--YSGDYYR 677
              LV  +  IA GM YLS+ N++HRDLAARN ++ +++   V+DFGL+R +  + G Y  
Sbjct: 2287 GQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYET 2466

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            QG   K+P++W A E++A  ++T  SDVW+FG+ MWE+++ G  PY  + N E+   +  
Sbjct: 2467 QG--GKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIED 2640

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
            G RL  P +C   +Y+LM  CW+ D  +RP F  L+  LE +L +   L T
Sbjct: 2641 GYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRT 2793
>gb|M18391.1|HUMTKR Human tyrosine kinase receptor (eph) mRNA, complete cds
          Length = 3370

 Score =  208 bits (530), Expect = 2e-51
 Identities = 194/651 (29%), Positives = 287/651 (43%), Gaps = 37/651 (5%)
 Frame = +1

Query: 175  PSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVA 234
            P  S     G T  T   CE+ + +  A      V    PP+AP N + +  S    S+ 
Sbjct: 985  PQQSTAESEGATICT---CESGHYR--APGEGPQVACTGPPSAPRNLSFSA-SGTQLSLR 1146

Query: 235  WVPGAD-----------------GLAL----LHSCTVQVAHAPGEWEALAVVVPVPPFTC 273
            W P AD                 G A        C V V  +PG   A A+  P      
Sbjct: 1147 WEPPADTGGRQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPG---ARALTTPAVH--- 1308

Query: 274  LLRNLAPATNYSLRVRCANA---LGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG-LI 329
             +  L P  NY+  V   N    LG S +       + G A + +  +   ++ +   L 
Sbjct: 1309 -VNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLE 1485

Query: 330  LEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNA 389
            L W    P  PG      Y+L  + ++  + ++++E  R  LT+  P    I+RV     
Sbjct: 1486 LTWAGSRPRSPGANLT--YELHVLNQDEERYQMVLE-PRVLLTELQPDTTYIVRVRMLTP 1656

Query: 390  IGDGPWSQPLVVSSHDHAGRQGPPHSRT----SWVPVVLGVXXXXXXXXXXXXXXXRK-- 443
            +G GP+S        DH  R  PP SR       V V+ G+               R+  
Sbjct: 1657 LGPGPFSP-------DHEFRTSPPVSRGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQ 1815

Query: 444  RRKETRFGQAFDSVMARGEPAVHF----RAARSFNRERPERIEATLDSLGISDELKEKLE 499
            R+++ R   A    + R   A       R  R+ +RE       TL   G S+    +L+
Sbjct: 1816 RQRQQRHVTAPPMWIERTSCAEALCGTSRHTRTLHRE-----PWTLPG-GWSNFPSRELD 1977

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
               +      +  ++G+GEFG V    L+        VA+K LK D         FLREA
Sbjct: 1978 PAWL-----MVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLK-DTSPGGQWWNFLREA 2139

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M +F HPH+  L GV  +     R PI M+I  FM++  L AFL      E    L  
Sbjct: 2140 TIMGQFSHPHILHLEGVVTK-----RKPI-MIITEFMENAALDAFLR-----EREDQLVP 2286

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKI--YSGDYYR 677
              LV  +  IA GM YLS+ N++HRDLAARN ++ +++   V+DFGL+R +  + G Y  
Sbjct: 2287 GQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYET 2466

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            QG   K+P++W A E++A  ++T  SDVW+FG+ MWE+++ G  PY  + N E+   +  
Sbjct: 2467 QG--GKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIED 2640

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLST 788
            G RL  P +C   +Y+LM  CW+ D  +RP F  L+  LE +L +   L T
Sbjct: 2641 GYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRT 2793
>emb|X56348.1|HSURFRET H.sapiens urf-ret mRNA
          Length = 1568

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +2

Query: 504 PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
           P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 440 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 613

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
            +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 614 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 775

Query: 617 --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                         L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 776 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 955

Query: 663 DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
           DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 956 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 1135

Query: 723 YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 1136YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 1309
>ref|NM_020629.1| Homo sapiens ret proto-oncogene (multiple endocrine neoplasia and
            medullary thyroid carcinoma 1, Hirschsprung disease)
            (RET), transcript variant 3, mRNA
          Length = 4209

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2353 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2526

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2527 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2688

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2689 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2868

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2869 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 3048

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 3049 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3222
>gb|AF286643.1|AF286643 Xenopus laevis c-ret (Ret) mRNA, complete cds
          Length = 3443

 Score =  208 bits (529), Expect = 2e-51
 Identities = 123/344 (35%), Positives = 197/344 (56%), Gaps = 26/344 (7%)
 Frame = +1

Query: 463  PAVHFRAARSFNRERPERIEA-----TLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKG 517
            PA  +  + S N  R   +++     ++D+  I ++ K +      P +   LG+ LG+G
Sbjct: 2089 PAQSYPVSYSSNNARRPSLDSMENQMSVDTFKIPEDPKWEF-----PRKNLVLGKTLGEG 2253

Query: 518  EFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            EFG V +A   +LK + G +  VAVKMLK +  + S++ + L E   +K+ +HPHV KL 
Sbjct: 2254 EFGKVVKATAFRLKGKAG-YTTVAVKMLK-ESASQSELRDLLSEFNLLKQVNHPHVIKLY 2427

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IG---------------ENPFN-- 616
            G   +       P+ +++  + K+G L +FL  SR +G               +NP    
Sbjct: 2428 GACTQDG-----PLHLIV-EYSKYGSLRSFLRESRKVGPSTLGGDSNRNSSYLDNPDERA 2589

Query: 617  LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DFGLSR +Y  D Y
Sbjct: 2590 LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSY 2769

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
             +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  PY GI    ++N L 
Sbjct: 2770 VKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLK 2949

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G R+++P  C +E+Y+LM +CW  +P++R +F  +  ELE ++
Sbjct: 2950 TGYRMEKPENCSDEMYNLMLKCWKQEPEKRQTFGEISKELEKMM 3081
>ref|XM_049008.2| Homo sapiens ret proto-oncogene (multiple endocrine neoplasia and
            medullary thyroid carcinoma 1, Hirschsprung disease)
            (RET), mRNA
          Length = 5616

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2353 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2526

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2527 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2688

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2689 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2868

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2869 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 3048

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 3049 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3222
>emb|X12949.1|HSRETPON Human ret proto-oncogene mRNA for tyrosine kinase
          Length = 4508

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2089 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2262

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2263 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2424

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2425 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2604

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2605 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 2784

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 2785 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 2958
>ref|NM_020630.1| Homo sapiens ret proto-oncogene (multiple endocrine neoplasia and
            medullary thyroid carcinoma 1, Hirschsprung disease)
            (RET), transcript variant 4, mRNA
          Length = 7003

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2353 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2526

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2527 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2688

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2689 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2868

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2869 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 3048

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 3049 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3222
>ref|NM_020975.1| Homo sapiens ret proto-oncogene (multiple endocrine neoplasia and
            medullary thyroid carcinoma 1, Hirschsprung disease)
            (RET), transcript variant 2, mRNA
          Length = 5615

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2353 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2526

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2527 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2688

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2689 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2868

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2869 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 3048

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 3049 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3222
>ref|NM_000323.1| Homo sapiens ret proto-oncogene (multiple endocrine neoplasia and
            medullary thyroid carcinoma 1, Hirschsprung disease)
            (RET), transcript variant 1, mRNA
          Length = 4383

 Score =  208 bits (529), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2353 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2526

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2527 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2688

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2689 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2868

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2869 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 3048

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 3049 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3222
>gb|BC004257.1|BC004257 Homo sapiens, ret proto-oncogene (multiple endocrine neoplasia MEN2A,
            MEN2B and medullary thyroid carcinoma 1, Hirschsprung
            disease), clone MGC:10752 IMAGE:3160389, mRNA, complete
            cds
          Length = 3486

 Score =  207 bits (528), Expect = 3e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 2338 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 2511

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 2512 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 2673

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 2674 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 2853

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 2854 DFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 3033

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 3034 YPGIPPERLFNLLKTGHRMERPDNCSEEMYCLMLQCWKQEPDKRPVFADISKDLEKMM 3207
>gb|L03357.1|HUMRETRI Homo sapiens fusion protein RET tyrosine kinase/cAMP protein kinase A
            subunit RI (RET/PTC2) mRNA, 5' end of cds
          Length = 1867

 Score =  207 bits (528), Expect = 3e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 739  PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 912

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 913  VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 1074

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 1075 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 1254

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 1255 DFGLSRDVYEEDPYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 1434

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 1435 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 1608
>gb|M16029.1|HUMTYKRET Human ret mRNA encoding a tyrosine kinase, partial cds
          Length = 2485

 Score =  207 bits (528), Expect = 3e-51
 Identities = 117/298 (39%), Positives = 172/298 (57%), Gaps = 21/298 (7%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            P +   LG+ LG+GEFG V +A    LK   G +  VAVKMLK +  + S++ + L E  
Sbjct: 1357 PRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG-YTTVAVKMLKENA-SPSELRDLLSEFN 1530

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFN--- 616
             +K+ +HPHV KL G   +    G L   ++I+ + K+G L  FL  SR +G        
Sbjct: 1531 VLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKYGSLRGFLRESRKVGPGYLGSGG 1692

Query: 617  --------------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVA 662
                          L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++
Sbjct: 1693 SRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKIS 1872

Query: 663  DFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTP 722
            DFGLSR +Y  D Y +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  P
Sbjct: 1873 DFGLSRDVYEEDPYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNP 2052

Query: 723  YAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            Y GI    ++N L  G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 2053 YPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 2226
>gb|J05047.1|GPIIRRA Guinea pig insulin receptor-related receptor (IRR) gene, complete cds
          Length = 3903

 Score =  207 bits (528), Expect = 3e-51
 Identities = 107/273 (39%), Positives = 166/273 (60%), Gaps = 5/273 (1%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS-DIEEFLREAAC 561
            +P +Q ++ R LG+G FG V E   K  +       V +   + +AS  +  EFL+EA+ 
Sbjct: 2920 VPREQISIIRELGQGSFGMVYEGVAKGLEAGEESTPVALKTVNELASPRERIEFLKEASV 3099

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI-GENPFNLP-- 618
            MK F   HV +L+GV  + +        +VI+  M  GDL + L + R   EN   +P  
Sbjct: 3100 MKAFQCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSHLRSLRPEAENNPGIPRP 3261

Query: 619  -LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L  +++   +IA GM YL++  F+HRDLAARNCM+++D TV + DFG++R +Y  DYYR
Sbjct: 3262 ALGDMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYR 3441

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W+A ESL D ++T HSDVW+FGV +WEI+T  + PY G+ N ++  +++ 
Sbjct: 3442 KGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMD 3621

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
            G  L++  +C  ++ +LM  CW  +P+ RP+FT
Sbjct: 3622 GGVLEELEDCPHQLQELMSSCWQQNPRLRPTFT 3720
>dbj|AB006561.3|AB006561 Ephydatia fluviatilis EfPTK16 mRNA for protein tyrosine kinase,
            complete cds
          Length = 2324

 Score =  207 bits (528), Expect = 3e-51
 Identities = 116/310 (37%), Positives = 183/310 (58%), Gaps = 16/310 (5%)
 Frame = +1

Query: 491  SDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIA 548
            S+ L+     +LIPEQ   +   +G+GEFG V  A L++  +  S   VAVK +K +  +
Sbjct: 1228 SNYLRHLSGKMLIPEQCLQIMDCIGQGEFGIVYRAYLREWAKYPSPHLVAVKTIKGET-S 1404

Query: 549  SSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFL--- 605
             S I + L E+  MK+FDHP++  L+GV +   +      P +++PFM +G L ++L   
Sbjct: 1405 DSQISQMLEESVKMKDFDHPNILSLIGVCIAIESS-----PYIVMPFMANGSLLSYLKQQ 1569

Query: 606  -----LASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
                 +A+   ++      + L+   + IA GMEYL+S+ F+HRDLAARNCM+  +  + 
Sbjct: 1570 RHNLTIANGAEQDLITETQRVLLSICLQIAKGMEYLASQKFVHRDLAARNCMIDLNNVIK 1749

Query: 661  VADFGLSRKIYSGDYYRQG----CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIM 716
            VADFGLS  +Y+ +YYRQ     C  KLP++W+A ES  D +++  +DVW++GVT WE+ 
Sbjct: 1750 VADFGLSEDMYAKNYYRQSDVEECKVKLPIRWMAPESFHDGVFSEKTDVWSYGVTCWEVF 1929

Query: 717  TRGQTPYAGIENAEIYNYLIGGNRLKQPPE--CMEEVYDLMYQCWSADPKQRPSFTCLRM 774
            T G+ PY G+    +  YL  G RL++P    C +++YDLM +CW  + + RP F+ L +
Sbjct: 1930 TLGKIPYPGVTPFTLIKYLDEGGRLEKPSNAACSDQIYDLMRKCWCQESEDRPPFSNLVL 2109

Query: 775  ELENILGHLS 784
             +  IL  L+
Sbjct: 2110 AICGILEPLA 2139
>ref|NM_002944.1| Homo sapiens v-ros UR2 sarcoma virus oncogene homolog 1 (avian)
            (ROS1), mRNA
          Length = 7375

 Score =  207 bits (528), Expect = 3e-51
 Identities = 123/297 (41%), Positives = 180/297 (60%), Gaps = 14/297 (4%)
 Frame = +3

Query: 495  KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREAQLKQEDG---SFVKVAVKMLKADIIASS 550
            +E++E++   P ++ TL  +LG G FG V E       G     +KVAVK LK     S+
Sbjct: 5997 QEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKK---GST 6167

Query: 551  DIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLAS 608
            D E  EFL+EA  M +F+HP++ K +GV L +  +       +IL  M+ GDL  +L  +
Sbjct: 6168 DQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQ------YIILELMEGGDLLTYLRKA 6329

Query: 609  RIGENPFNLPLQTLVRFM---VDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT----VC 660
            R+    F  PL TLV  +   VDI+ G  YL   +FIHRDLAARNC+++ +D T    V 
Sbjct: 6330 RMAT--FYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVK 6503

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            + DFGL+R IY  DYYR+     LPV+W+A ESL D ++T  SDVW+FG+ +WEI+T G 
Sbjct: 6504 IGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGH 6683

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
             PY    N ++ NY+  G RL+ P  C +++++LM QCW+ +P QRP+F  ++ +L+
Sbjct: 6684 QPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQNQLQ 6854
>gb|M34353.1|HUMROSA Human transmembrane tyrosine-specific protein kinase (ROS1) mRNA,
            complete cds
          Length = 7375

 Score =  207 bits (528), Expect = 3e-51
 Identities = 123/297 (41%), Positives = 180/297 (60%), Gaps = 14/297 (4%)
 Frame = +3

Query: 495  KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREAQLKQEDG---SFVKVAVKMLKADIIASS 550
            +E++E++   P ++ TL  +LG G FG V E       G     +KVAVK LK     S+
Sbjct: 5997 QEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKK---GST 6167

Query: 551  DIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLAS 608
            D E  EFL+EA  M +F+HP++ K +GV L +  +       +IL  M+ GDL  +L  +
Sbjct: 6168 DQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQ------YIILELMEGGDLLTYLRKA 6329

Query: 609  RIGENPFNLPLQTLVRFM---VDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT----VC 660
            R+    F  PL TLV  +   VDI+ G  YL   +FIHRDLAARNC+++ +D T    V 
Sbjct: 6330 RMAT--FYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVK 6503

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            + DFGL+R IY  DYYR+     LPV+W+A ESL D ++T  SDVW+FG+ +WEI+T G 
Sbjct: 6504 IGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGH 6683

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
             PY    N ++ NY+  G RL+ P  C +++++LM QCW+ +P QRP+F  ++ +L+
Sbjct: 6684 QPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQNQLQ 6854
>ref|NM_009050.1| Mus musculus ret proto-oncogene (Ret), mRNA
          Length = 3348

 Score =  207 bits (527), Expect = 4e-51
 Identities = 128/344 (37%), Positives = 193/344 (55%), Gaps = 26/344 (7%)
 Frame = +1

Query: 463  PAVHFRAARSFNRERPERIEAT-----LDSLGISDELKEKLEDVLIPEQQFTLGRMLGKG 517
            PA  F  + S +  R   +++T     +DS  I ++ K +      P +   LG+ LG+G
Sbjct: 2038 PAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIPEDPKWEF-----PRKNLVLGKTLGEG 2202

Query: 518  EFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            EFG V  A   +LK   G +  VAVK LK +  + S++ + L E   +K+ +HPHV KL 
Sbjct: 2203 EFGKVVXATAFRLKGRAG-YTTVAVKXLKENA-SQSELRDLLSEFNLLKQVNHPHVIKLY 2376

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IG---------------ENPFN-- 616
            G   +    G L   ++I+ + K+G L  FL  SR IG               ++P    
Sbjct: 2377 GACSQD---GPL---LLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLDHPDERV 2538

Query: 617  LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DFGLSR +Y  D Y
Sbjct: 2539 LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSY 2718

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
             +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  PY GI    ++N L 
Sbjct: 2719 VKKSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLK 2898

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 2899 TGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3030
>emb|X67812.1|MMRET M.musculus mRNA for ret proto-oncogene
          Length = 3348

 Score =  207 bits (527), Expect = 4e-51
 Identities = 128/344 (37%), Positives = 193/344 (55%), Gaps = 26/344 (7%)
 Frame = +1

Query: 463  PAVHFRAARSFNRERPERIEAT-----LDSLGISDELKEKLEDVLIPEQQFTLGRMLGKG 517
            PA  F  + S +  R   +++T     +DS  I ++ K +      P +   LG+ LG+G
Sbjct: 2038 PAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIPEDPKWEF-----PRKNLVLGKTLGEG 2202

Query: 518  EFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            EFG V  A   +LK   G +  VAVK LK +  + S++ + L E   +K+ +HPHV KL 
Sbjct: 2203 EFGKVVXATAFRLKGRAG-YTTVAVKXLKENA-SQSELRDLLSEFNLLKQVNHPHVIKLY 2376

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IG---------------ENPFN-- 616
            G   +    G L   ++I+ + K+G L  FL  SR IG               ++P    
Sbjct: 2377 GACSQD---GPL---LLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLDHPDERV 2538

Query: 617  LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DFGLSR +Y  D Y
Sbjct: 2539 LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSY 2718

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
             +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  PY GI    ++N L 
Sbjct: 2719 VKKSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLK 2898

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G+R+++P  C EE+Y LM QCW  +P +RP F  +  +LE ++
Sbjct: 2899 TGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMM 3030
>gb|M13880.1|HUMROSMCF Human mcf3 (rearranged ros1) proto-oncogene mRNA encoding a
           transmembrane protein kinase, 3' end
          Length = 1681

 Score =  207 bits (527), Expect = 4e-51
 Identities = 123/297 (41%), Positives = 180/297 (60%), Gaps = 14/297 (4%)
 Frame = +3

Query: 495 KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREAQLKQEDG---SFVKVAVKMLKADIIASS 550
           +E++E++   P ++ TL  +LG G FG V E       G     +KVAVK LK     S+
Sbjct: 234 QEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKK---GST 404

Query: 551 DIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLAS 608
           D E  EFL+EA  M +F+HP++ K +GV L +  +       +IL  M+ GDL  +L  +
Sbjct: 405 DQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQ------YIILELMEGGDLLTYLRKA 566

Query: 609 RIGENPFNLPLQTLVRFM---VDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT----VC 660
           R+    F  PL TLV  +   VDI+ G  YL   +FIHRDLAARNC+++ +D T    V 
Sbjct: 567 RMAT--FYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVK 740

Query: 661 VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
           + DFGL+R IY  DYYR+     LPV+W+A ESL D ++T  SDVW+FG+ +WEI+T G 
Sbjct: 741 IGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGH 920

Query: 721 TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
            PY    N ++ NY+  G RL+ P  C +++++LM QCW+ +P QRP+F  ++ +L+
Sbjct: 921 QPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQ 1091
>emb|AJ299016.1|RNO299016 Rattus norvegicus mRNA for receptor tyrosine kinase (Ret gene),
            isoform RET51
          Length = 5074

 Score =  207 bits (527), Expect = 4e-51
 Identities = 121/320 (37%), Positives = 184/320 (56%), Gaps = 21/320 (6%)
 Frame = +2

Query: 482  EATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVA 538
            + ++DS  I ++ K +      P +   LG+ LG+GEFG V +A   +LK   G +  VA
Sbjct: 2126 QVSVDSFKIPEDPKWEF-----PRKNLVLGKTLGEGEFGKVVKATAFRLKDRAG-YTTVA 2287

Query: 539  VKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH 598
            VKMLK +  + S++ + L E   +K+ +HPHV KL G   +    G L   ++I+ + K+
Sbjct: 2288 VKMLKENA-SQSELRDLLSEFNLLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKY 2446

Query: 599  GDLHAFLLASR-IG---------------ENPFN--LPLQTLVRFMVDIACGMEYLSSRN 640
            G L  FL  SR IG               ++P    L +  L+ F   I+ GM+YL+   
Sbjct: 2447 GSLRGFLRDSRKIGPAYVSSGGSRNSSSLDHPDERVLTMGDLISFAWQISRGMQYLAEMK 2626

Query: 641  FIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYT 700
             +HRDLAARN ++AE   + ++DFGLSR +Y  D Y +    ++PV W+A+ SL+D+ YT
Sbjct: 2627 LVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKKSXGRIPVNWMAINSLSDHFYT 2806

Query: 701  VHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWS 760
              SDVW+FGV +WEI+T G  PY GI    ++N L  G+R+++P  C EE+Y LM QCW 
Sbjct: 2807 TQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPNNCSEEMYRLMLQCWK 2986

Query: 761  ADPKQRPSFTCLRMELENIL 780
             +P +RP F  +  +LE ++
Sbjct: 2987 QEPDKRPVFADISKDLEKMM 3046
>emb|AJ299017.1|RNO299017 Rattus norvegicus mRNA for receptor tyrosine kinase (Ret gene),
            isoform RET9
          Length = 3676

 Score =  207 bits (527), Expect = 4e-51
 Identities = 121/320 (37%), Positives = 184/320 (56%), Gaps = 21/320 (6%)
 Frame = +2

Query: 482  EATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVA 538
            + ++DS  I ++ K +      P +   LG+ LG+GEFG V +A   +LK   G +  VA
Sbjct: 2126 QVSVDSFKIPEDPKWEF-----PRKNLVLGKTLGEGEFGKVVKATAFRLKDRAG-YTTVA 2287

Query: 539  VKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKH 598
            VKMLK +  + S++ + L E   +K+ +HPHV KL G   +    G L   ++I+ + K+
Sbjct: 2288 VKMLKENA-SQSELRDLLSEFNLLKQVNHPHVIKLYGACSQD---GPL---LLIVEYAKY 2446

Query: 599  GDLHAFLLASR-IG---------------ENPFN--LPLQTLVRFMVDIACGMEYLSSRN 640
            G L  FL  SR IG               ++P    L +  L+ F   I+ GM+YL+   
Sbjct: 2447 GSLRGFLRDSRKIGPAYVSSGGSRNSSSLDHPDERVLTMGDLISFAWQISRGMQYLAEMK 2626

Query: 641  FIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYT 700
             +HRDLAARN ++AE   + ++DFGLSR +Y  D Y +    ++PV W+A+ SL+D+ YT
Sbjct: 2627 LVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKKSXGRIPVNWMAINSLSDHFYT 2806

Query: 701  VHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWS 760
              SDVW+FGV +WEI+T G  PY GI    ++N L  G+R+++P  C EE+Y LM QCW 
Sbjct: 2807 TQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPNNCSEEMYRLMLQCWK 2986

Query: 761  ADPKQRPSFTCLRMELENIL 780
             +P +RP F  +  +LE ++
Sbjct: 2987 QEPDKRPVFADISKDLEKMM 3046
>ref|XM_043563.2| Homo sapiens insulin receptor-related receptor (INSRR), mRNA
          Length = 3808

 Score =  206 bits (525), Expect = 6e-51
 Identities = 108/273 (39%), Positives = 166/273 (60%), Gaps = 5/273 (1%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS-DIEEFLREAAC 561
            +P +Q ++ R LG+G FG V E   +  +       V +   + +AS  +  EFL+EA+ 
Sbjct: 2834 VPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASPRECIEFLKEASV 3013

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI-GENPFNLP-- 618
            MK F   HV +L+GV  + +        +VI+  M  GDL + L + R   EN   LP  
Sbjct: 3014 MKAFKCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSHLRSLRPEAENNPGLPQP 3175

Query: 619  -LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L  +++   +IA GM YL++  F+HRDLAARNCM+++D TV + DFG++R +Y  DYYR
Sbjct: 3176 ALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYR 3355

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W+A ESL D ++T HSDVW+FGV +WEI+T  + PY G+ N ++  +++ 
Sbjct: 3356 KGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMD 3535

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
            G  L++   C  ++ +LM +CW  +P+ RPSFT
Sbjct: 3536 GGVLEELEGCPLQLQELMSRCWQPNPRLRPSFT 3634
>gb|J05046.1|HUMIRRA Human insulin receptor-related receptor (IRR) mRNA, 3 ' end
          Length = 3809

 Score =  206 bits (525), Expect = 6e-51
 Identities = 108/273 (39%), Positives = 166/273 (60%), Gaps = 5/273 (1%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS-DIEEFLREAAC 561
            +P +Q ++ R LG+G FG V E   +  +       V +   + +AS  +  EFL+EA+ 
Sbjct: 2835 VPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASPRECIEFLKEASV 3014

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI-GENPFNLP-- 618
            MK F   HV +L+GV  + +        +VI+  M  GDL + L + R   EN   LP  
Sbjct: 3015 MKAFKCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSHLRSLRPEAENNPGLPQP 3176

Query: 619  -LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L  +++   +IA GM YL++  F+HRDLAARNCM+++D TV + DFG++R +Y  DYYR
Sbjct: 3177 ALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYR 3356

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W+A ESL D ++T HSDVW+FGV +WEI+T  + PY G+ N ++  +++ 
Sbjct: 3357 KGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMD 3536

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT 770
            G  L++   C  ++ +LM +CW  +P+ RPSFT
Sbjct: 3537 GGVLEELEGCPLQLQELMSRCWQPNPRLRPSFT 3635
>gb|AF007949.1|AF007949 Danio rerio receptor tyrosine kinase (c-ret) mRNA, complete cds
          Length = 4145

 Score =  206 bits (524), Expect = 8e-51
 Identities = 124/344 (36%), Positives = 195/344 (56%), Gaps = 26/344 (7%)
 Frame = +1

Query: 463  PAVHFRAARSFNRERPERIEA-----TLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKG 517
            PA  +  + S N  R   +++      +D+  I ++ K +      P +   LG+ +G+G
Sbjct: 2122 PAQSYPISYSANNVRRASLDSMENQVAIDTFKIPEDPKWEF-----PRKNLVLGKTVGEG 2286

Query: 518  EFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            EFG V +A   +LK + G +  VAVKMLK +  + S++ + L E   +K+ +HPHV K+ 
Sbjct: 2287 EFGKVVKATAFRLKGKAG-YTTVAVKMLKENA-SHSELRDLLSEFTLLKQVNHPHVIKMY 2460

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IG---------------ENPFN-- 616
            G   +    G L    +I+ + K+G L  FL  SR +G               ENP    
Sbjct: 2461 GACSQD---GPL---YLIVEYAKYGSLRNFLRESRKVGPSYMGNDANRNSSYLENPDERA 2622

Query: 617  LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DFGLSR +Y  D Y
Sbjct: 2623 LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSY 2802

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
             +    ++PVKW+A+ESL D++YT  SDVW+FGV +WEI+T G  PY GI    ++N L 
Sbjct: 2803 VKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLK 2982

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G R+++P  C +E+Y+LM +CW  +  +RP+F+ +  ELE ++
Sbjct: 2983 TGYRMEKPENCTDEMYNLMLRCWKQESDKRPTFSDISKELEKMM 3114
>ref|XM_033355.1| Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 1
            (ABL1), mRNA
          Length = 5437

 Score =  206 bits (524), Expect = 8e-51
 Identities = 122/303 (40%), Positives = 170/303 (55%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 781  TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 942

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 943  NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVNAVVLLYMATQ 1092

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1093 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1269

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 1270 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 1449

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGS 808
            E+VY+LM  CW  +P  RPSF  +    E +    S+    +  L     R    T   +
Sbjct: 1450 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQA 1629

Query: 809  PEL 811
            PEL
Sbjct: 1630 PEL 1638
>emb|X16416.1|HSABL Human c-abl mRNA encoding p150 protein
          Length = 5527

 Score =  206 bits (524), Expect = 8e-51
 Identities = 122/303 (40%), Positives = 170/303 (55%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 874  TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 1035

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 1036 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVNAVVLLYMATQ 1185

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1186 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1362

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 1363 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 1542

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAEQPTESGS 808
            E+VY+LM  CW  +P  RPSF  +    E +    S+    +  L     R    T   +
Sbjct: 1543 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQA 1722

Query: 809  PEL 811
            PEL
Sbjct: 1723 PEL 1731
>emb|X94363.1|DRRET1 D.rerio ret1 gene for receptor tyrosine kinase
          Length = 3599

 Score =  206 bits (524), Expect = 8e-51
 Identities = 125/344 (36%), Positives = 194/344 (56%), Gaps = 26/344 (7%)
 Frame = +2

Query: 463  PAVHFRAARSFNRERPERIEA-----TLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKG 517
            PA  +  + S N  R   +++      +D+  I ++ K +      P +   LG+ LG+G
Sbjct: 2129 PAQSYPISYSANNVRRASLDSMENQVAIDTFKIPEDPKWEF-----PRKNLVLGKTLGEG 2293

Query: 518  EFGSVREA---QLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            EFG V +A   +LK + G +  VAVKMLK +  + S++ + L E   +K+ +HPHV K+ 
Sbjct: 2294 EFGKVVKATAFRLKGKAG-YTTVAVKMLKENA-SHSELRDLLSEFTLLKQVNHPHVIKMY 2467

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IG---------------ENPFN-- 616
            G   +    G L    +I+ + K+G L  FL  SR +G               ENP    
Sbjct: 2468 GACSQD---GPL---YLIVEYAKYGSLRNFLRESRKVGPSYMGNDANRNSSYLENPDERA 2629

Query: 617  LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY 676
            L +  L+ F   I+ GM+YL+    +HRDLAARN ++AE   + ++DFGLSR +Y  D Y
Sbjct: 2630 LTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSY 2809

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
             +    ++PVKW+A ESL D++YT  SDVW+FGV +WEI+T G  PY GI    ++N L 
Sbjct: 2810 VKRSKGRIPVKWMATESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLK 2989

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
             G R+++P  C +E+Y+LM +CW  +  +RP+F+ +  ELE ++
Sbjct: 2990 TGYRMEKPENCTDEMYNLMLRCWKQESDKRPTFSDISKELEKMM 3121
>ref|XM_011817.3| Homo sapiens muscle, skeletal, receptor tyrosine kinase (MUSK), mRNA
          Length = 2666

 Score =  206 bits (523), Expect = 1e-50
 Identities = 129/310 (41%), Positives = 175/310 (55%), Gaps = 24/310 (7%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1727 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1894

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1895 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2053

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L+ R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2054 MSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2233

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E+M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2234 NCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYG 2413

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2414 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSF 2593

Query: 770  TCLRMELENI 779
            T +   LE +
Sbjct: 2594 TSIHRILERM 2623
 Score = 54.7 bits (130), Expect = 4e-05
 Identities = 65/256 (25%), Positives = 100/256 (38%), Gaps = 17/256 (6%)
 Frame = +2

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K  + ++  S++++  S     G L + +V+
Sbjct: 425 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLES-----GSLRIHNVQ 589

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A G P P
Sbjct: 590 KEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPVP 769

Query: 159 VTIYWWRGLTKVGGPAPSPSVLN-------VTGVTQRTEFSCEARNIKG--LATSRPAIV 209
            TI W      V   +   SV +          +T+   ++C A N  G   +T++ A  
Sbjct: 770 -TITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT 946

Query: 210 RLQAPPAAPFNTTVTTISSYNASVA-WVPGADGLALLHSCTVQVAHAP-----GEWEALA 263
              A  + P        + Y   V   V   D L  L++       A        W  L 
Sbjct: 947 ISIAAFSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELK 1126

Query: 264 VVVPV--PPFTCLLRN 277
           VV PV  P    LL N
Sbjct: 1127VVSPVCRPAAEALLCN 1174
 Score = 48.5 bits (114), Expect = 0.003
 Identities = 42/165 (25%), Positives = 76/165 (45%), Gaps = 6/165 (3%)
 Frame = +2

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 191 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCTANNGV 361

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGP 173
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G + +   
Sbjct: 362 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKGDSPLREN 538

Query: 174 AP----SPSVLNVTGVTQRT--EFSCEARNIKGLATSRPAIVRLQ 212
           +         L +  V +    ++ C A+N  G A S+  +V+L+
Sbjct: 539 SRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSK--VVKLE 667
>ref|NM_005592.1| Homo sapiens muscle, skeletal, receptor tyrosine kinase (MUSK), mRNA
          Length = 2666

 Score =  206 bits (523), Expect = 1e-50
 Identities = 129/310 (41%), Positives = 175/310 (55%), Gaps = 24/310 (7%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1727 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1894

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1895 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2053

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L+ R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2054 MSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2233

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E+M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2234 NCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYG 2413

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2414 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSF 2593

Query: 770  TCLRMELENI 779
            T +   LE +
Sbjct: 2594 TSIHRILERM 2623
 Score = 54.7 bits (130), Expect = 4e-05
 Identities = 65/256 (25%), Positives = 100/256 (38%), Gaps = 17/256 (6%)
 Frame = +2

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K  + ++  S++++  S     G L + +V+
Sbjct: 425 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLES-----GSLRIHNVQ 589

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A G P P
Sbjct: 590 KEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPVP 769

Query: 159 VTIYWWRGLTKVGGPAPSPSVLN-------VTGVTQRTEFSCEARNIKG--LATSRPAIV 209
            TI W      V   +   SV +          +T+   ++C A N  G   +T++ A  
Sbjct: 770 -TITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT 946

Query: 210 RLQAPPAAPFNTTVTTISSYNASVA-WVPGADGLALLHSCTVQVAHAP-----GEWEALA 263
              A  + P        + Y   V   V   D L  L++       A        W  L 
Sbjct: 947 ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELK 1126

Query: 264 VVVPV--PPFTCLLRN 277
           VV PV  P    LL N
Sbjct: 1127VVSPVCRPAAEALLCN 1174
 Score = 48.5 bits (114), Expect = 0.003
 Identities = 42/165 (25%), Positives = 76/165 (45%), Gaps = 6/165 (3%)
 Frame = +2

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 191 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCTANNGV 361

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGP 173
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G + +   
Sbjct: 362 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKGDSPLREN 538

Query: 174 AP----SPSVLNVTGVTQRT--EFSCEARNIKGLATSRPAIVRLQ 212
           +         L +  V +    ++ C A+N  G A S+  +V+L+
Sbjct: 539 SRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSK--VVKLE 667
>gb|AF006464.1|AF006464 Homo sapiens muscle specific tyrosine kinase receptor (MUSK) mRNA,
            complete cds
          Length = 2666

 Score =  206 bits (523), Expect = 1e-50
 Identities = 129/310 (41%), Positives = 175/310 (55%), Gaps = 24/310 (7%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1727 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1894

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1895 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2053

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L+ R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2054 MSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2233

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E+M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2234 NCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYG 2413

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2414 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSF 2593

Query: 770  TCLRMELENI 779
            T +   LE +
Sbjct: 2594 TSIHRILERM 2623
 Score = 54.7 bits (130), Expect = 4e-05
 Identities = 65/256 (25%), Positives = 100/256 (38%), Gaps = 17/256 (6%)
 Frame = +2

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K  + ++  S++++  S     G L + +V+
Sbjct: 425 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLES-----GSLRIHNVQ 589

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A G P P
Sbjct: 590 KEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPVP 769

Query: 159 VTIYWWRGLTKVGGPAPSPSVLN-------VTGVTQRTEFSCEARNIKG--LATSRPAIV 209
            TI W      V   +   SV +          +T+   ++C A N  G   +T++ A  
Sbjct: 770 -TITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT 946

Query: 210 RLQAPPAAPFNTTVTTISSYNASVA-WVPGADGLALLHSCTVQVAHAP-----GEWEALA 263
              A  + P        + Y   V   V   D L  L++       A        W  L 
Sbjct: 947 ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELK 1126

Query: 264 VVVPV--PPFTCLLRN 277
           VV PV  P    LL N
Sbjct: 1127VVSPVCRPAAEALLCN 1174
 Score = 48.5 bits (114), Expect = 0.003
 Identities = 42/165 (25%), Positives = 76/165 (45%), Gaps = 6/165 (3%)
 Frame = +2

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 191 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCTANNGV 361

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGP 173
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G + +   
Sbjct: 362 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKGDSPLREN 538

Query: 174 AP----SPSVLNVTGVTQRT--EFSCEARNIKGLATSRPAIVRLQ 212
           +         L +  V +    ++ C A+N  G A S+  +V+L+
Sbjct: 539 SRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSK--VVKLE 667
>gb|L10656.1|MUSCABL Mouse tyrosine kinase (c-abl) mRNA
          Length = 3653

 Score =  205 bits (522), Expect = 1e-50
 Identities = 116/277 (41%), Positives = 162/277 (57%)
 Frame = +1

Query: 509 TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
           T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 379 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 540

Query: 569 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
           ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 541 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVSAVVLLYMATQ 690

Query: 629 IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
           I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 691 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 867

Query: 689 LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
            A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 868 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 1047

Query: 749 EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
           E+VY+LM  CW  +P  RPSF  +    E +    S+
Sbjct: 1048EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI 1158
>gb|M35105.1|RATCROS1B Rat lung-derived L01 c-ros-1 proto-oncogene mRNA, complete cds
          Length = 8010

 Score =  205 bits (522), Expect = 1e-50
 Identities = 119/296 (40%), Positives = 179/296 (60%), Gaps = 13/296 (4%)
 Frame = +3

Query: 495  KEKLEDV-LIPEQQFTLGRMLGKGEFGSVREA---QLKQEDGSFVKVAVKMLKADIIASS 550
            +E++E +   P ++ +L  +LG G FG V E     +       +KVAVK LK     S+
Sbjct: 6276 QEEIESLPAFPREKLSLRLLLGSGAFGEVYEGTAVDILGRGSGEIKVAVKTLKK---GST 6446

Query: 551  DIE--EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLAS 608
            D E  EFL+EA  M +F+HP++ K +GV L S  +       +IL  M+ GDL ++L  +
Sbjct: 6447 DQEKIEFLKEAHLMSKFNHPNILKQLGVCLLSEPQ------YIILELMEGGDLLSYLRKA 6608

Query: 609  R--IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA-EDMT----VCV 661
            R      P  L L  LV   VDI+ G  YL   +FIHRDLAARNC+++ +D T    V +
Sbjct: 6609 RGTTLSGPL-LTLADLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRVVKI 6785

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
             DFGL+R+IY  DYYR+     LPV+W+A E+L D ++T  SDVW+FG+ +WEI+T G  
Sbjct: 6786 GDFGLAREIYKHDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEILTLGHQ 6965

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
            PY    N ++ NY+  G RL+ P  C +++++LM++CW+ +P QRP+F  ++ +L+
Sbjct: 6966 PYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMFRCWAQEPDQRPTFYNIQDQLQ 7133
>emb|X02963.1|REABMLVA Abelson (P160) murine leukemia virus (Ab-MLV) abl gene
          Length = 3884

 Score =  205 bits (522), Expect = 1e-50
 Identities = 116/277 (41%), Positives = 162/277 (57%)
 Frame = +1

Query: 509 TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
           T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 385 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 546

Query: 569 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
           ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 547 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVSAVVLLYMATQ 696

Query: 629 IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
           I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 697 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 873

Query: 689 LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
            A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 874 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 1053

Query: 749 EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
           E+VY+LM  CW  +P  RPSF  +    E +    S+
Sbjct: 1054EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI 1164
>gb|AF033812.1|AF033812 Abelson murine leukemia virus, complete genome
          Length = 5894

 Score =  205 bits (522), Expect = 1e-50
 Identities = 116/277 (41%), Positives = 162/277 (57%)
 Frame = +3

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 1710 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 1871

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 1872 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVSAVVLLYMATQ 2021

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 2022 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 2198

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 2199 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 2378

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
            E+VY+LM  CW  +P  RPSF  +    E +    S+
Sbjct: 2379 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI 2489
>emb|V01541.1|REAMLV Abelson murine leukemia virus genome with v-abl oncogene. The virus
            is shown as integrated in the murine genome. It has two
            reading frames and long terminal repeats
          Length = 5893

 Score =  205 bits (522), Expect = 1e-50
 Identities = 116/277 (41%), Positives = 162/277 (57%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 2236 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 2397

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 2398 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVSAVVLLYMATQ 2547

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 2548 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 2724

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 2725 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 2904

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
            E+VY+LM  CW  +P  RPSF  +    E +    S+
Sbjct: 2905 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI 3015
>gb|J02009.1|MLAPRO Abelson murine leukemia virus (proviral), complete genome with
            p120-gag-abl polyprotein gene
          Length = 5894

 Score =  205 bits (522), Expect = 1e-50
 Identities = 116/277 (41%), Positives = 162/277 (57%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 2236 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 2397

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 2398 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVSAVVLLYMATQ 2547

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 2548 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 2724

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 2725 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 2904

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
            E+VY+LM  CW  +P  RPSF  +    E +    S+
Sbjct: 2905 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI 3015
>gb|J02995.1|MUSABLTS Mouse testis-specific c-abl protein mRNA, complete cds
          Length = 5058

 Score =  205 bits (522), Expect = 1e-50
 Identities = 116/277 (41%), Positives = 162/277 (57%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 778  TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 939

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 940  NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVSAVVLLYMATQ 1089

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1090 ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1266

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 1267 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 1446

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
            E+VY+LM  CW  +P  RPSF  +    E +    S+
Sbjct: 1447 EKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI 1557
>gb|L11311.1|FSCTRKA Torpedo californica receptor tyrosine kinase mRNA, complete cds
          Length = 3400

 Score =  204 bits (519), Expect = 3e-50
 Identities = 127/331 (38%), Positives = 179/331 (53%), Gaps = 27/331 (8%)
 Frame = +1

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L QE  + V  AVKMLK +  AS
Sbjct: 2032 LNAKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPHLLPQETSTMV--AVKMLKEE--AS 2199

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFLL- 606
             D++ +F REAA M EF+HP++ KL+GV     A G+   PM +L  +M HGDL+ +L  
Sbjct: 2200 PDMQADFRREAALMAEFNHPNIVKLLGVC----AVGK---PMCLLFEYMAHGDLNEYLRK 2358

Query: 607  -----------------ASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAAR 649
                             +S  G+    L     +     I+ GM YLS R F+HRDLA R
Sbjct: 2359 RSPITARTLRPANCVGWSSGWGKGLTALSCADQLNIAKQISAGMTYLSERKFVHRDLATR 2538

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E + V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2539 NCLVGEKLVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFFNRYTTESDVWAYG 2718

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RP+F
Sbjct: 2719 VVLWEIFSSGMQPYYGMAHEEVIYYVRDGNILSCPENCPPELYNLMRLCWSNMPSDRPTF 2898

Query: 770  TCLRMELENILGHLSV---LSTSQDPLYINI 797
              +   LE +   ++    + +   PLY+ +
Sbjct: 2899 ASIHRILERMHQRMAAALPV*SPLPPLYLGV 2991
 Score = 52.8 bits (125), Expect = 2e-04
 Identities = 44/143 (30%), Positives = 60/143 (41%)
 Frame = +1

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P  +    G  V L CS  G   P I W KD T ++N  Q   S+ E    G L +++V+
Sbjct: 505 PTDVRALLGSKVVLPCSTMGNPKPAISWFKDETALKN-DQPRTSVLES---GNLRIRNVQ 672

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
             DAG Y C  ++    + S+S  L V+        P    V   +   L C+A G P P
Sbjct: 673 LEDAGKYRCLARNSLGFEYSRSAALEVQVSARIVKAPTSQNVSYGSEVILQCKATGFPIP 852

Query: 159 VTIYWWRGLTKVGGPAPSPSVLN 181
            TI W       G   P  S+ N
Sbjct: 853 -TIKWLEN----GRAVPKGSIQN 906
 Score = 52.0 bits (123), Expect = 3e-04
 Identities = 43/166 (25%), Positives = 70/166 (41%), Gaps = 7/166 (4%)
 Frame = +1

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+V+     +I W ++   ++       S  E+  I  L++ SVE +D G+Y C   +G 
Sbjct: 271 CAVDSYPAAEITWTRNNIPIR-PFDTRYSTKENGQI--LTILSVEDTDNGVYCCTANNGM 441

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGP 173
            +       L V+  P     P D+     +   L C  +G P+P  I W++  T +   
Sbjct: 442 GSSAQSCGALQVKMKPKIIRPPTDVRALLGSKVVLPCSTMGNPKP-AISWFKDETALKND 618

Query: 174 APSPSVLNVTGVTQRT-------EFSCEARNIKGLATSRPAIVRLQ 212
            P  SVL    +  R        ++ C ARN  G   SR A + +Q
Sbjct: 619 QPRTSVLESGNLRIRNVQLEDAGKYRCLARNSLGFEYSRSAALEVQ 756
>gb|AF236106.1|AF236106 Drosophila melanogaster receptor protein tyrosine kinase ALK splice
            variant A mRNA, complete cds
          Length = 8435

 Score =  204 bits (518), Expect = 4e-50
 Identities = 110/291 (37%), Positives = 165/291 (55%), Gaps = 6/291 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEEFLREAA 560
            +      L   LGKG FG V  A  +  DG  V+  VAVK L+ D     + E+FL+EAA
Sbjct: 3939 VARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKE-EDFLKEAA 4115

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFNLPL 619
             M +F+HP++  L+GV        R P   ++L  +  GDL  FL  +R   E P  L +
Sbjct: 4116 IMAKFNHPNMVHLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTM 4277

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAED---MTVCVADFGLSRKIYSGDYY 676
            + L+   +D+A G  Y+ S+ FIHRD+AARNC+L+       V +ADFG+SR IY  DYY
Sbjct: 4278 KDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYY 4457

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LP+KW+  E+  D ++T  +DVW+FG+ +WE+ + G++PY G  N ++   ++
Sbjct: 4458 RKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVV 4637

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
             G RL  P EC   +Y +M  CW+  P+ RP+F  L   L       S+++
Sbjct: 4638 RGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMN 4790
>ref|NM_011832.1| Mus musculus insulin receptor-related receptor (Insrr), mRNA
          Length = 4991

 Score =  204 bits (518), Expect = 4e-50
 Identities = 106/272 (38%), Positives = 164/272 (59%), Gaps = 5/272 (1%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS-DIEEFLREAAC 561
            +P +Q  + R LG+G FG V E   +  +       V +   + +AS+ +  EFL+EA+ 
Sbjct: 3282 VPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASARERVEFLKEASV 3461

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI-GENPFNLP-- 618
            MK F   HV +L+GV  + +        +VI+  M  GDL + L + R   EN   LP  
Sbjct: 3462 MKAFKCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSHLRSLRPEAENNPGLPQP 3623

Query: 619  -LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L  +++   +IA GM YL+++ F+HRDLAARNCM+++D TV + DFG++R +Y  DYYR
Sbjct: 3624 ALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYR 3803

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W+A ESL D ++T HSDVW+FGV +WEI+T  + PY G+ N ++  +++ 
Sbjct: 3804 KGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMD 3983

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            G  L++   C  ++ +LM  CW   P+ RP+F
Sbjct: 3984 GGVLEELENCPIQLQELMRLCWQHSPRLRPTF 4079
>dbj|AB007135.1|AB007135 Mus musculus IRR mRNA for insulin receptor-related receptor, complete
            cds
          Length = 4991

 Score =  204 bits (518), Expect = 4e-50
 Identities = 106/272 (38%), Positives = 164/272 (59%), Gaps = 5/272 (1%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS-DIEEFLREAAC 561
            +P +Q  + R LG+G FG V E   +  +       V +   + +AS+ +  EFL+EA+ 
Sbjct: 3282 VPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASARERVEFLKEASV 3461

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI-GENPFNLP-- 618
            MK F   HV +L+GV  + +        +VI+  M  GDL + L + R   EN   LP  
Sbjct: 3462 MKAFKCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSHLRSLRPEAENNPGLPQP 3623

Query: 619  -LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYR 677
             L  +++   +IA GM YL+++ F+HRDLAARNCM+++D TV + DFG++R +Y  DYYR
Sbjct: 3624 ALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYR 3803

Query: 678  QGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIG 737
            +G    LPV+W+A ESL D ++T HSDVW+FGV +WEI+T  + PY G+ N ++  +++ 
Sbjct: 3804 KGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMD 3983

Query: 738  GNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            G  L++   C  ++ +LM  CW   P+ RP+F
Sbjct: 3984 GGVLEELENCPIQLQELMRLCWQHSPRLRPTF 4079
>gb|AF025542.1|AF025542 Bombyx mori insulin receptor-like protein precursor (BIR) mRNA,
            complete cds
          Length = 6020

 Score =  204 bits (518), Expect = 4e-50
 Identities = 115/316 (36%), Positives = 176/316 (55%), Gaps = 13/316 (4%)
 Frame = +2

Query: 512  RMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPH 569
            R LG+G FG V E   K+  +     + A+K +         IE FL EA+ MK FD  H
Sbjct: 3476 RELGQGSFGMVYEGIAKEIVKGKPETRCAIKTVNEHATDRERIE-FLNEASVMKAFDTFH 3652

Query: 570  VAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI---GENPFNLP----LQTL 622
            V +L+GV  R +        +V++  M+ GDL  +L + R    G  P + P    LQ +
Sbjct: 3653 VVRLLGVVSRGQPT------LVVMELMERGDLKTYLRSMRPDAEGSLPSSPPVPPTLQNI 3814

Query: 623  VRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCAS 682
            ++  ++IA GM YLS++ F+HRDLAARNCM+A D+TV V DFG++R IY  DYYR+G   
Sbjct: 3815 LQMAIEIADGMAYLSAKKFVHRDLAARNCMVAGDLTVKVGDFGMTRDIYETDYYRKGTKG 3994

Query: 683  KLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLK 742
             +PV+W++ ESL D +++  SD W++GV +WE+ T    PY G+ N ++  Y++ G  ++
Sbjct: 3995 LMPVRWMSPESLKDGVFSSSSDAWSYGVVLWEMATLAMQPYQGLSNEQVLRYVVEGGVME 4174

Query: 743  QPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL----ENILGHLSVLSTSQDPLYINIE 798
            +P +C + +Y+LM  CW+  P  RP+F  L  +L         H S   + Q      ++
Sbjct: 4175 RPEQCPDRLYELMRACWTHRPSARPTFLQLVADLVPHAMPYFRHRSFFHSPQGQELYALQ 4354

Query: 799  RAEQPTESGSPELHCG 814
            R+    E   PE+  G
Sbjct: 4355 RSALDEEQELPEVDVG 4402
>ref|XM_080568.1| Alk, mRNA
          Length = 8454

 Score =  204 bits (518), Expect = 4e-50
 Identities = 110/291 (37%), Positives = 165/291 (55%), Gaps = 6/291 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEEFLREAA 560
            +      L   LGKG FG V  A  +  DG  V+  VAVK L+ D     + E+FL+EAA
Sbjct: 3939 VARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKE-EDFLKEAA 4115

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFNLPL 619
             M +F+HP++  L+GV        R P   ++L  +  GDL  FL  +R   E P  L +
Sbjct: 4116 IMAKFNHPNMVHLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTM 4277

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAED---MTVCVADFGLSRKIYSGDYY 676
            + L+   +D+A G  Y+ S+ FIHRD+AARNC+L+       V +ADFG+SR IY  DYY
Sbjct: 4278 KDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYY 4457

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LP+KW+  E+  D ++T  +DVW+FG+ +WE+ + G++PY G  N ++   ++
Sbjct: 4458 RKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVV 4637

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
             G RL  P EC   +Y +M  CW+  P+ RP+F  L   L       S+++
Sbjct: 4638 RGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMN 4790
>gb|AE003806.2|AE003806 Drosophila melanogaster genomic scaffold 142000013386047 section 37 of
              52, complete sequence
          Length = 268219

 Score =  203 bits (517), Expect = 5e-50
 Identities = 109/280 (38%), Positives = 163/280 (57%), Gaps = 6/280 (2%)
 Frame = -3

Query: 514    LGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEEFLREAACMKEFDHPHVA 571
              LGKG FG V  A  +  DG  V+  VAVK L+ D     + E+FL+EAA M +F+HP++ 
Sbjct: 172946 LGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKE-EDFLKEAAIMAKFNHPNMV 172770

Query: 572    KLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFNLPLQTLVRFMVDIA 630
               L+GV        R P   ++L  +  GDL  FL  +R   E P  L ++ L+   +D+A
Sbjct: 172769 HLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVA 172608

Query: 631    CGMEYLSSRNFIHRDLAARNCMLAED---MTVCVADFGLSRKIYSGDYYRQGCASKLPVK 687
               G  Y+ S+ FIHRD+AARNC+L+       V +ADFG+SR IY  DYYR+G  + LP+K
Sbjct: 172607 KGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIK 172428

Query: 688    WLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPEC 747
              W+  E+  D ++T  +DVW+FG+ +WE+ + G++PY G  N ++   ++ G RL  P EC
Sbjct: 172427 WMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTEC 172248

Query: 748    MEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
                 +Y +M  CW+  P+ RP+F  L   L       S+++
Sbjct: 172247 PVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMN 172128
 Score = 41.6 bits (96), Expect = 0.36
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 1/98 (1%)
 Frame = +3

Query: 622    LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
              L R   ++  G+++L S   IHRDL  +N +++    + +ADFGL+ K Y  +       
Sbjct: 126705 LQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-KTYGSE---MKLT 126872

Query: 682    SKLPVKWL-ALESLADNLYTVHSDVWAFGVTMWEIMTR 718
              S +   W  A E L    Y    D+W+    ++E+  R
Sbjct: 126873 SVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNR 126986
>gb|AC091501.1|AC091501 Drosophila melanogaster, chromosome 2R, region 53D-53E, BAC clone
             BACR36P23, complete sequence
          Length = 198390

 Score =  203 bits (517), Expect = 5e-50
 Identities = 109/280 (38%), Positives = 163/280 (57%), Gaps = 6/280 (2%)
 Frame = -2

Query: 514   LGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEEFLREAACMKEFDHPHVA 571
             LGKG FG V  A  +  DG  V+  VAVK L+ D     + E+FL+EAA M +F+HP++ 
Sbjct: 73832 LGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKE-EDFLKEAAIMAKFNHPNMV 73656

Query: 572   KLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFNLPLQTLVRFMVDIA 630
              L+GV        R P   ++L  +  GDL  FL  +R   E P  L ++ L+   +D+A
Sbjct: 73655 HLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVA 73494

Query: 631   CGMEYLSSRNFIHRDLAARNCMLAED---MTVCVADFGLSRKIYSGDYYRQGCASKLPVK 687
              G  Y+ S+ FIHRD+AARNC+L+       V +ADFG+SR IY  DYYR+G  + LP+K
Sbjct: 73493 KGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIK 73314

Query: 688   WLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPEC 747
             W+  E+  D ++T  +DVW+FG+ +WE+ + G++PY G  N ++   ++ G RL  P EC
Sbjct: 73313 WMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTEC 73134

Query: 748   MEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
                +Y +M  CW+  P+ RP+F  L   L       S+++
Sbjct: 73133 PVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMN 73014
 Score = 41.6 bits (96), Expect = 0.36
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 1/98 (1%)
 Frame = +1

Query: 622   LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
             L R   ++  G+++L S   IHRDL  +N +++    + +ADFGL+ K Y  +       
Sbjct: 27592 LQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-KTYGSE---MKLT 27759

Query: 682   SKLPVKWL-ALESLADNLYTVHSDVWAFGVTMWEIMTR 718
             S +   W  A E L    Y    D+W+    ++E+  R
Sbjct: 27760 SVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNR 27873
>gb|AC004287.1|AC004287 Drosophila melanogaster DNA sequence (P1 DS02309 (D166)), complete
             sequence
          Length = 70841

 Score =  203 bits (517), Expect = 5e-50
 Identities = 109/280 (38%), Positives = 163/280 (57%), Gaps = 6/280 (2%)
 Frame = -2

Query: 514   LGKGEFGSVREAQLKQEDGSFVK--VAVKMLKADIIASSDIEEFLREAACMKEFDHPHVA 571
             LGKG FG V  A  +  DG  V+  VAVK L+ D     + E+FL+EAA M +F+HP++ 
Sbjct: 46348 LGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKE-EDFLKEAAIMAKFNHPNMV 46172

Query: 572   KLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR-IGENPFNLPLQTLVRFMVDIA 630
              L+GV        R P   ++L  +  GDL  FL  +R   E P  L ++ L+   +D+A
Sbjct: 46171 HLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVA 46010

Query: 631   CGMEYLSSRNFIHRDLAARNCMLAED---MTVCVADFGLSRKIYSGDYYRQGCASKLPVK 687
              G  Y+ S+ FIHRD+AARNC+L+       V +ADFG+SR IY  DYYR+G  + LP+K
Sbjct: 46009 KGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIK 45830

Query: 688   WLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPEC 747
             W+  E+  D ++T  +DVW+FG+ +WE+ + G++PY G  N ++   ++ G RL  P EC
Sbjct: 45829 WMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTEC 45650

Query: 748   MEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
                +Y +M  CW+  P+ RP+F  L   L       S+++
Sbjct: 45649 PVSIYKVMADCWNPTPEDRPTFITLLEHLTACTQDASIMN 45530
 Score = 41.6 bits (96), Expect = 0.36
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 1/98 (1%)
 Frame = +3

Query: 622 LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
           L R   ++  G+++L S   IHRDL  +N +++    + +ADFGL+ K Y  +       
Sbjct: 108 LQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-KTYGSE---MKLT 275

Query: 682 SKLPVKWL-ALESLADNLYTVHSDVWAFGVTMWEIMTR 718
           S +   W  A E L    Y    D+W+    ++E+  R
Sbjct: 276 SVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNR 389
>gb|AF322653.1|AF322653 Drosophila melanogaster tyrosine kinase Ret isoform 2 (D-ret) mRNA,
            complete cds
          Length = 4871

 Score =  202 bits (515), Expect = 9e-50
 Identities = 123/326 (37%), Positives = 179/326 (54%), Gaps = 19/326 (5%)
 Frame = +2

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQEDG--SFVKVAVKMLKADIIASSDIE--EFLREA 559
            P ++  L  +LG+GEFG V +    +  G      VAVKMLK     S+ +E    L E 
Sbjct: 2675 PREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKK---GSNSVEYMALLSEF 2845

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI--------- 610
              ++E  HP+V KL+G    S A      P++I+ + ++G L ++L  SR          
Sbjct: 2846 QLLQEVSHPNVIKLLGACTSSEA------PLLIIEYARYGSLRSYLRLSRKIECAGVDFA 3007

Query: 611  -GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
             G  P N+ +  ++ F   I  GM YLS    +HRDLAARN +LA+     ++DFGL+R 
Sbjct: 3008 DGVEPVNVKM--VLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRD 3181

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
            +Y  D Y +    ++PVKW+A ESLAD++YT  SDVW+FGV  WE++T G +PY GI   
Sbjct: 3182 VYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQ 3361

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV---L 786
             +++ L  G R+ +P  C E VY ++  CW+ +P  RPSF  L  E E +LG+ +    L
Sbjct: 3362 NLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNNAKYIDL 3541

Query: 787  STS--QDPLYINIERAEQPTESGSPE 810
             T+   +PLY   + A   TE G PE
Sbjct: 3542 ETNAVSNPLYCGDDSALITTELGEPE 3619
>emb|X71424.1|BTTIE2A B.taurus Tie 2 mRNA
          Length = 4625

 Score =  202 bits (515), Expect = 9e-50
 Identities = 166/562 (29%), Positives = 261/562 (45%), Gaps = 18/562 (3%)
 Frame = +3

Query: 264  VVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIR 323
            + VP    + LL NL P   Y +R R           D + +    + P + P+N     
Sbjct: 2097 IKVPGNLTSVLLNNLHPREQYIVRARVNTKAQGEWSEDLIAWTLSDIVPPQ-PENIKIFN 2273

Query: 324  -TDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGT--RANLTDWDPQKDL 380
             TDS  ++ W  ++        +  YK+    E+   D  +   T  +  L   +PQ   
Sbjct: 2274 ITDSSAVISWT-ILDGYSISAIIIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPQTVY 2450

Query: 381  ILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWVPVVLG---VXXXXXXXXXXX 437
             + + A N IG    +    +++   +        R   +  +LG   +           
Sbjct: 2451 QVDIFAENNIGSSNPTSSHELTTLSESQAPADLGGRKMLLIAILGSAGMTCLTVLLAFLI 2630

Query: 438  XXXXRKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGISDELKE 496
                ++   + R  QAF +V  R EPAV F +   + NR+     + T+    + D    
Sbjct: 2631 MLQLKRANVQRRMAQAFQNV--REEPAVQFNSGTLALNRKAKNNPDPTI--YPVLDWNDI 2798

Query: 497  KLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFL 556
            K +DV+            G+G FG V +A++K+ DG  +  A+K +K +  +  D  +F 
Sbjct: 2799 KFQDVI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDDHRDFA 2936

Query: 557  REAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP- 614
             E   + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+ E   
Sbjct: 2937 GELEVLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRVLETDP 3098

Query: 615  ---------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFG 665
                       L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    +ADFG
Sbjct: 3099 AFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFG 3278

Query: 666  LSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
            LSR     + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G TPY G
Sbjct: 3279 LSR---GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCG 3449

Query: 726  IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
            +  AE+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L     
Sbjct: 3450 MTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML----- 3614

Query: 786  LSTSQDPLYINIERAEQPTESG 807
                +   Y+N    E+ T +G
Sbjct: 3615 ---EERKTYVNTTLYEKFTYAG 3671
>ref|NM_057696.1| Drosophila melanogaster Ret oncogene (Ret), transcript variant
            Ret-P1|CDS, mRNA
          Length = 3708

 Score =  202 bits (515), Expect = 9e-50
 Identities = 123/326 (37%), Positives = 179/326 (54%), Gaps = 19/326 (5%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQEDG--SFVKVAVKMLKADIIASSDIE--EFLREA 559
            P ++  L  +LG+GEFG V +    +  G      VAVKMLK     S+ +E    L E 
Sbjct: 2299 PREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKK---GSNSVEYMALLSEF 2469

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI--------- 610
              ++E  HP+V KL+G    S A      P++I+ + ++G L ++L  SR          
Sbjct: 2470 QLLQEVSHPNVIKLLGACTSSEA------PLLIIEYARYGSLRSYLRLSRKIECAGVDFA 2631

Query: 611  -GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
             G  P N+ +  ++ F   I  GM YLS    +HRDLAARN +LA+     ++DFGL+R 
Sbjct: 2632 DGVEPVNVKM--VLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRD 2805

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
            +Y  D Y +    ++PVKW+A ESLAD++YT  SDVW+FGV  WE++T G +PY GI   
Sbjct: 2806 VYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQ 2985

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV---L 786
             +++ L  G R+ +P  C E VY ++  CW+ +P  RPSF  L  E E +LG+ +    L
Sbjct: 2986 NLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNNAKYIDL 3165

Query: 787  STS--QDPLYINIERAEQPTESGSPE 810
             T+   +PLY   + A   TE G PE
Sbjct: 3166 ETNAVSNPLYCGDDSALITTELGEPE 3243
>gb|AF322652.1|AF322652 Drosophila melanogaster tyrosine kinase Ret isoform 1 (D-ret) mRNA,
            complete cds
          Length = 4813

 Score =  202 bits (515), Expect = 9e-50
 Identities = 123/326 (37%), Positives = 179/326 (54%), Gaps = 19/326 (5%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQEDG--SFVKVAVKMLKADIIASSDIE--EFLREA 559
            P ++  L  +LG+GEFG V +    +  G      VAVKMLK     S+ +E    L E 
Sbjct: 2617 PREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKK---GSNSVEYMALLSEF 2787

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI--------- 610
              ++E  HP+V KL+G    S A      P++I+ + ++G L ++L  SR          
Sbjct: 2788 QLLQEVSHPNVIKLLGACTSSEA------PLLIIEYARYGSLRSYLRLSRKIECAGVDFA 2949

Query: 611  -GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
             G  P N+ +  ++ F   I  GM YLS    +HRDLAARN +LA+     ++DFGL+R 
Sbjct: 2950 DGVEPVNVKM--VLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRD 3123

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
            +Y  D Y +    ++PVKW+A ESLAD++YT  SDVW+FGV  WE++T G +PY GI   
Sbjct: 3124 VYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQ 3303

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV---L 786
             +++ L  G R+ +P  C E VY ++  CW+ +P  RPSF  L  E E +LG+ +    L
Sbjct: 3304 NLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNNAKYIDL 3483

Query: 787  STS--QDPLYINIERAEQPTESGSPE 810
             T+   +PLY   + A   TE G PE
Sbjct: 3484 ETNAVSNPLYCGDDSALITTELGEPE 3561
>emb|AJ237973.1|DME237973 Drosophila melanogaster mRNA for Ret receptor tyrosine kinase,
            variant III splice, intact CDS
          Length = 4899

 Score =  202 bits (515), Expect = 9e-50
 Identities = 123/326 (37%), Positives = 179/326 (54%), Gaps = 19/326 (5%)
 Frame = +2

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQEDG--SFVKVAVKMLKADIIASSDIE--EFLREA 559
            P ++  L  +LG+GEFG V +    +  G      VAVKMLK     S+ +E    L E 
Sbjct: 2762 PREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKK---GSNSVEYMALLSEF 2932

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI--------- 610
              ++E  HP+V KL+G    S A      P++I+ + ++G L ++L  SR          
Sbjct: 2933 QLLQEVSHPNVIKLLGACTSSEA------PLLIIEYARYGSLRSYLRLSRKIECAGVDFA 3094

Query: 611  -GENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
             G  P N+ +  ++ F   I  GM YLS    +HRDLAARN +LA+     ++DFGL+R 
Sbjct: 3095 DGVEPVNVKM--VLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRD 3268

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
            +Y  D Y +    ++PVKW+A ESLAD++YT  SDVW+FGV  WE++T G +PY GI   
Sbjct: 3269 VYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQ 3448

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV---L 786
             +++ L  G R+ +P  C E VY ++  CW+ +P  RPSF  L  E E +LG+ +    L
Sbjct: 3449 NLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNNAKYIDL 3628

Query: 787  STS--QDPLYINIERAEQPTESGSPE 810
             T+   +PLY   + A   TE G PE
Sbjct: 3629 ETNAVSNPLYCGDDSALITTELGEPE 3706
>ref|NM_031061.1| Rattus norvegicus Muscle specific kinase (neural fold/somite kinase
            1) (Nsk1), mRNA
          Length = 2855

 Score =  202 bits (514), Expect = 1e-49
 Identities = 127/310 (40%), Positives = 175/310 (55%), Gaps = 24/310 (7%)
 Frame = +1

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1798 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1965

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1966 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2124

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2125 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2304

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E+M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2305 NCLVGENMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2484

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2485 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2664

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2665 CSIHRILQRM 2694
 Score = 55.5 bits (132), Expect = 2e-05
 Identities = 36/125 (28%), Positives = 59/125 (46%)
 Frame = +1

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K  + ++  S++++  S     G L + +V+
Sbjct: 499 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSALRENSRIAVLES-----GSLRIHNVQ 663

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A+G P P
Sbjct: 664 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGMPVP 843

Query: 159 VTIYW 163
            TI W
Sbjct: 844 -TISW 855
 Score = 48.1 bits (113), Expect = 0.004
 Identities = 32/113 (28%), Positives = 54/113 (47%)
 Frame = +1

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 265 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCTANNGV 435

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRG 166
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G
Sbjct: 436 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKG 591
>gb|U34985.1|RNU34985 Rattus norvegicus muscle-specific tyrosine kinase receptor MuSK mRNA,
            complete cds
          Length = 2855

 Score =  202 bits (514), Expect = 1e-49
 Identities = 127/310 (40%), Positives = 175/310 (55%), Gaps = 24/310 (7%)
 Frame = +1

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1798 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1965

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1966 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2124

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2125 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2304

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E+M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2305 NCLVGENMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2484

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2485 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2664

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2665 CSIHRILQRM 2694
 Score = 55.5 bits (132), Expect = 2e-05
 Identities = 36/125 (28%), Positives = 59/125 (46%)
 Frame = +1

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K  + ++  S++++  S     G L + +V+
Sbjct: 499 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSALRENSRIAVLES-----GSLRIHNVQ 663

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A+G P P
Sbjct: 664 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGMPVP 843

Query: 159 VTIYW 163
            TI W
Sbjct: 844 -TISW 855
 Score = 48.1 bits (113), Expect = 0.004
 Identities = 32/113 (28%), Positives = 54/113 (47%)
 Frame = +1

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 265 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCTANNGV 435

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRG 166
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G
Sbjct: 436 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKG 591
>gb|M15805.1|FCSHZ2A Hardy-Zuckerman 2 feline sarcoma virus (HZ2-FeSV) proviral DNA,
           partial cds
          Length = 2091

 Score =  202 bits (514), Expect = 1e-49
 Identities = 115/272 (42%), Positives = 161/272 (58%)
 Frame = +1

Query: 509 TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
           T+   LG G++G V E   K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 730 TMKHKLGGGQYGEVYEGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 891

Query: 569 HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
           ++ +L+GV  R       P   +I  FM +G+L  +L       N   +    L+     
Sbjct: 892 NLVQLLGVCTRE------PPFYIITEFMTYGNLLDYLREC----NRQEVNAVVLLYMATQ 1041

Query: 629 IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
           I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1042ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR-LMTGDTYTAHAGTKFPIKW 1218

Query: 689 LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
            A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y  L    R+++P  C 
Sbjct: 1219TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP 1398

Query: 749 EEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
           E+VY+LM  CW  +P  RP+F  +  +   IL
Sbjct: 1399EKVYELMRACWQWNPSDRPAFAEIHHDCLQIL 1494
>gb|AF062498.1|AF062498 Oncorhynchus mykiss insulin receptor c (IRc) mRNA, partial cds
          Length = 2016

 Score =  202 bits (513), Expect = 2e-49
 Identities = 108/278 (38%), Positives = 161/278 (57%), Gaps = 7/278 (2%)
 Frame = +1

Query: 499  EDVLIPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFL 556
            +D  +   +  + R LG+G FG V E   K   +      VAVK +         IE FL
Sbjct: 865  DDWEVGRDKINILRELGQGSFGMVYEGIAKDIVKGEPDTSVAVKTVNESASLRERIE-FL 1041

Query: 557  REAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI-GENPF 615
             +A+ MK F   HV +L+GV  + +        +V++  M HGDL ++L   R   EN  
Sbjct: 1042 NKASVMKGFTCHHVVRLMGVVSKGQPT------LVVMKLMTHGDLKSYLRCFRPDSENTL 1203

Query: 616  NLP----LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY 671
                   L+ +++   +IA GM YL+++ F+HRDLAARNCM+A+D TV + DFG++R IY
Sbjct: 1204 QGARPPLLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAQDFTVKIGDFGMTRDIY 1383

Query: 672  SGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEI 731
              DYYR+G    LPV+W+A ESL D ++T +SD W+FGV +WE+ T  + PY G+ N ++
Sbjct: 1384 ETDYYRKGGKGLLPVRWMAPESLKDGVFTANSDCWSFGVVLWEVSTLAEQPYQGLSNEQV 1563

Query: 732  YNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
              +++ G  L +P  C + ++DLM  CW  +PK RPSF
Sbjct: 1564 LKFVMDGGFLDRPDNCADRLHDLMSMCWQYNPKLRPSF 1677
>ref|NM_010944.1| Mus musculus muscle, skeletal, receptor tyrosine kinase (Musk), mRNA
          Length = 2646

 Score =  201 bits (512), Expect = 2e-49
 Identities = 127/310 (40%), Positives = 174/310 (55%), Gaps = 24/310 (7%)
 Frame = +1

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1687 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1854

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1855 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2013

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2014 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2193

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2194 NCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2373

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2374 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2553

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2554 CSIHRILQRM 2583
 Score = 51.6 bits (122), Expect = 3e-04
 Identities = 35/125 (28%), Positives = 57/125 (45%)
 Frame = +1

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K    ++  S+++   S     G L + +V+
Sbjct: 379 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAALES-----GSLRIHNVQ 543

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE +      P+   V   +   L C  +G P P
Sbjct: 544 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVLGRILRAPESHNVTFGSFVTLRCTEIGIPVP 723

Query: 159 VTIYW 163
            TI W
Sbjct: 724 -TISW 735
 Score = 48.1 bits (113), Expect = 0.004
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 6/165 (3%)
 Frame = +1

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 145 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCIANNGV 315

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGG- 172
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G   +   
Sbjct: 316 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKGDNALREN 492

Query: 173 ---PAPSPSVLNVTGVTQRT--EFSCEARNIKGLATSRPAIVRLQ 212
               A     L +  V +    ++ C A+N  G A S+  +V+L+
Sbjct: 493 SRIAALESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSK--LVKLE 621
>gb|U37708.1|MMU37708 Mus musculus muscle localized kinase 1 (MLK1) mRNA, complete cds
          Length = 3328

 Score =  201 bits (512), Expect = 2e-49
 Identities = 127/310 (40%), Positives = 174/310 (55%), Gaps = 24/310 (7%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1802 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1969

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1970 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2128

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2129 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2308

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2309 NCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2488

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2489 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2668

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2669 CSIHRILQRM 2698
 Score = 54.7 bits (130), Expect = 4e-05
 Identities = 36/125 (28%), Positives = 58/125 (45%)
 Frame = +2

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K    ++  S++++  S     G L + +V+
Sbjct: 527 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAVLES-----GSLRIHNVQ 691

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A+G P P
Sbjct: 692 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGIPVP 871

Query: 159 VTIYW 163
            TI W
Sbjct: 872 -TISW 883
 Score = 47.4 bits (111), Expect = 0.007
 Identities = 32/113 (28%), Positives = 54/113 (47%)
 Frame = +2

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 293 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCIANNGV 463

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRG 166
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G
Sbjct: 464 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKG 619
>emb|X86445.1|MMNSK22 M.musculus Nsk2 gene 3132bp
          Length = 3132

 Score =  201 bits (512), Expect = 2e-49
 Identities = 127/310 (40%), Positives = 174/310 (55%), Gaps = 24/310 (7%)
 Frame = +1

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1732 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1899

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1900 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2058

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2059 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2238

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2239 NCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2418

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2419 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2598

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2599 CSIHRILQRM 2628
 Score = 51.6 bits (122), Expect = 3e-04
 Identities = 35/125 (28%), Positives = 57/125 (45%)
 Frame = +1

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K    ++  S+++   S     G L + +V+
Sbjct: 424 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAALES-----GSLRIHNVQ 588

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE +      P+   V   +   L C  +G P P
Sbjct: 589 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVLGRILRAPESHNVTFGSFVTLRCTEIGIPVP 768

Query: 159 VTIYW 163
            TI W
Sbjct: 769 -TISW 780
 Score = 48.1 bits (113), Expect = 0.004
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 6/165 (3%)
 Frame = +1

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 190 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCIANNGV 360

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGG- 172
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G   +   
Sbjct: 361 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKGDNALREN 537

Query: 173 ---PAPSPSVLNVTGVTQRT--EFSCEARNIKGLATSRPAIVRLQ 212
               A     L +  V +    ++ C A+N  G A S+  +V+L+
Sbjct: 538 SRIAALESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSK--LVKLE 666
>gb|U37709.1|MMU37709 Mus musculus muscle localized kinase 2 (MLK2) mRNA, complete cds
          Length = 3352

 Score =  201 bits (512), Expect = 2e-49
 Identities = 127/310 (40%), Positives = 174/310 (55%), Gaps = 24/310 (7%)
 Frame = +2

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1826 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1993

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1994 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2152

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2153 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2332

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2333 NCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2512

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2513 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2692

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2693 CSIHRILQRM 2722
 Score = 54.7 bits (130), Expect = 4e-05
 Identities = 36/125 (28%), Positives = 58/125 (45%)
 Frame = +2

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K    ++  S++++  S     G L + +V+
Sbjct: 527 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAVLES-----GSLRIHNVQ 691

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE        P+   V   +   L C A+G P P
Sbjct: 692 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGIPVP 871

Query: 159 VTIYW 163
            TI W
Sbjct: 872 -TISW 883
 Score = 47.4 bits (111), Expect = 0.007
 Identities = 32/113 (28%), Positives = 54/113 (47%)
 Frame = +2

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 293 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCIANNGV 463

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRG 166
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G
Sbjct: 464 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKG 619
>emb|X86444.1|MMNSK21 M.musculus Nsk2 gene 3257bp
          Length = 3257

 Score =  201 bits (512), Expect = 2e-49
 Identities = 127/310 (40%), Positives = 174/310 (55%), Gaps = 24/310 (7%)
 Frame = +1

Query: 494  LKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIAS 549
            L  KL  +  P       R +G+G FG V +A+    L  E   F  VAVKMLK +  AS
Sbjct: 1732 LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP--FTMVAVKMLKEE--AS 1899

Query: 550  SDIE-EFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVIL-PFMKHGDLHAFL-- 605
            +D++ +F REAA M EFD+P++ KL+GV     A G+   PM +L  +M +GDL+ FL  
Sbjct: 1900 ADMQADFQREAALMAEFDNPNIVKLLGVC----AVGK---PMCLLFEYMAYGDLNEFLRS 2058

Query: 606  -------------LASRIG-ENPFNLPLQTLVRFMV--DIACGMEYLSSRNFIHRDLAAR 649
                         L++R    +P   PL    +  +   +A GM YLS R F+HRDLA R
Sbjct: 2059 MSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATR 2238

Query: 650  NCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFG 709
            NC++ E M V +ADFGLSR IYS DYY+      +P++W+  ES+  N YT  SDVWA+G
Sbjct: 2239 NCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTTESDVWAYG 2418

Query: 710  VTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            V +WEI + G  PY G+ + E+  Y+  GN L  P  C  E+Y+LM  CWS  P  RPSF
Sbjct: 2419 VVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSKLPADRPSF 2598

Query: 770  TCLRMELENI 779
              +   L+ +
Sbjct: 2599 CSIHRILQRM 2628
 Score = 51.6 bits (122), Expect = 3e-04
 Identities = 35/125 (28%), Positives = 57/125 (45%)
 Frame = +1

Query: 39  PVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVE 98
           P+ + + +G    L C+  G   P + W+K    ++  S+++   S     G L + +V+
Sbjct: 424 PINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAALES-----GSLRIHNVQ 588

Query: 99  RSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEP 158
           + DAG Y C  K+   T  S+ V L VE +      P+   V   +   L C  +G P P
Sbjct: 589 KEDAGQYRCVAKNSLGTAYSKLVKLEVEVLGRILRAPESHNVTFGSFVTLRCTEIGIPVP 768

Query: 159 VTIYW 163
            TI W
Sbjct: 769 -TISW 780
 Score = 48.1 bits (113), Expect = 0.004
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 6/165 (3%)
 Frame = +1

Query: 54  CSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGE 113
           C+VE    P+I W ++  +++       SI E+    LL++ SVE SD G+Y C   +G 
Sbjct: 190 CAVESYPQPEISWTRNKILIK-LFDTRYSIRENGQ--LLTILSVEDSDDGIYCCIANNGV 360

Query: 114 ETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGG- 172
              +     L V+  P  T  P ++ +       L C  +G P+P ++ W +G   +   
Sbjct: 361 GGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKP-SVSWIKGDNALREN 537

Query: 173 ---PAPSPSVLNVTGVTQRT--EFSCEARNIKGLATSRPAIVRLQ 212
               A     L +  V +    ++ C A+N  G A S+  +V+L+
Sbjct: 538 SRIAALESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSK--LVKLE 666
>gb|AF348085.1|AF348085 Danio rerio focal adhesion kinase mRNA, complete cds
          Length = 3895

 Score =  201 bits (510), Expect = 4e-49
 Identities = 116/325 (35%), Positives = 179/325 (54%), Gaps = 12/325 (3%)
 Frame = +1

Query: 468  RAARSFNRE-RPERIEATLDSLGISDELKEKLE-----------DVLIPEQQFTLGRMLG 515
            +A +S N E R + + A   S+  +D+  E ++           D  I   +  LGR +G
Sbjct: 1330 KAPKSANHEKRLQGVRAKAISISETDDYAEIIDEEDTYTMPSTRDYEIQRDRIELGRCIG 1509

Query: 516  KGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVG 575
            +G+FG V +      D   + VA+K  K +  + S  E+FL+EA  M++FDHPH+ KL+G
Sbjct: 1510 EGQFGDVHQGIYICPDTPALSVAIKTCK-NCTSDSVREKFLQEALTMRQFDHPHIVKLIG 1686

Query: 576  VSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEY 635
            V   +      P+  +I+     G+L +FL   +     +NL L +L+ F   ++  + Y
Sbjct: 1687 VITEN------PV-WIIMELCTLGELRSFLQIRK-----YNLDLASLILFSYQLSTALAY 1830

Query: 636  LSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLA 695
            L S+ F+HRD+AARN +++    V + DFGLSR +    YY+     KLP+KW+A ES+ 
Sbjct: 1831 LESKRFVHRDIAARNVLVSSVDCVKLGDFGLSRYMEDSSYYKAS-KGKLPIKWMAPESIN 2007

Query: 696  DNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLM 755
               +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G RL  PP C   +Y LM
Sbjct: 2008 FRRFTSASDVWMFGVCMWEILMYGVKPFQGVKNNDVIGRIENGERLAMPPNCPPTLYSLM 2187

Query: 756  YQCWSADPKQRPSFTCLRMELENIL 780
             +CW+ DP +RP FT L+ +L  IL
Sbjct: 2188 TKCWAYDPSKRPRFTELKGQLSTIL 2262
>emb|X84994.1|LSMIPRMR L.stagnalis mRNA for putative molluscan insulin-related peptide
            receptor
          Length = 5866

 Score =  201 bits (510), Expect = 4e-49
 Identities = 117/291 (40%), Positives = 166/291 (56%), Gaps = 6/291 (2%)
 Frame = +3

Query: 488  LGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLK---QEDGSFVKVAVKMLKA 544
            L ISDE +       +   +  L + LG+G FG V E   K    +    + VAVK +  
Sbjct: 3639 LYISDEWE-------VDRDKIKLIKELGQGSFGMVYEGVAKGIRDDPNEEIPVAVKTVN- 3794

Query: 545  DIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAF 604
            D  + SD  EFL+EA  MKEF   HV KL+GV    +        +VI+  M  GDL  +
Sbjct: 3795 DRASFSDRREFLKEATTMKEFHCHHVVKLLGVVSTGQPA------LVIMELMALGDLKNY 3956

Query: 605  LLASRIGEN-PFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCV 661
            L   R  E+ P  +P  L  +++   +IA GM YL+ + F+HRDLAARNCM++E+ TV +
Sbjct: 3957 LRGHRPDEDHPGVMPPHLLDILQMAGEIADGMAYLADKKFVHRDLAARNCMVSEERTVKI 4136

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
             DFG++R IY  DYYR+G    LPV+W+A ESL D ++T  SDVW++GV MWE++T    
Sbjct: 4137 GDFGMTRDIYETDYYRKGGKGMLPVRWMAPESLKDGVFTSLSDVWSYGVVMWEMVTLAAQ 4316

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCL 772
            PY G+ N E+  ++  G  ++ P  C  E+  LM  CW+  P QRP+F  +
Sbjct: 4317 PYQGLSNEEVVKFISDGYIMELPENCPNEMAYLMQHCWAKKPNQRPTFKAI 4469
>dbj|AB054534.1|AB054534 Gallus gallus mRNA for tyrosine kinase receptor EphA9, complete cds
          Length = 3924

 Score =  200 bits (508), Expect = 6e-49
 Identities = 185/627 (29%), Positives = 279/627 (43%), Gaps = 23/627 (3%)
 Frame = +3

Query: 175  PSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVA 234
            P  S+ N  G T     SC A   +  A S    +    PP+AP N + + ++    S+ 
Sbjct: 948  PPNSLSNELGATS---CSCNAGFYR--APSEGQNIACTRPPSAPRNVSFS-LTGTQLSLW 1109

Query: 235  WVPGADGLA---LLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRN------LAPATNYS 285
            W P +D      L ++   Q  H          VV  P  + L +       L   TNY+
Sbjct: 1110 WQPPSDHGGRKDLTYTVFCQRCHFLSCDPCEPGVVFSPSSSGLTKTAVDVDGLEAYTNYT 1289

Query: 286  LRVRCANA---LGPSPYGD----WVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPE 338
              V   N    +GP+P       WV       AP    Q     R DS L + W  + P 
Sbjct: 1290 FAVEAHNGVSGMGPAPQRTAPAVWVA--VGHAAPVTVSQFILTQRDDSSLSVSW--LAPR 1457

Query: 339  DPGEGPLGPYKLSWVQENGTQDELMVEGT---RANLTDWDPQKDLILRVCASNAIGDGPW 395
                  +  Y++ +  E G +    V+        LTD  P    +LRV +   +G GP+
Sbjct: 1458 QRSRTSV-EYEVMFF-EKGEEARYTVKHLLEPNVTLTDLQPDTTYLLRVRSITPLGPGPY 1631

Query: 396  SQPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFD 455
            SQ       +   R  PP +      V+  +                 RRK+    QA  
Sbjct: 1632 SQ-------EQEFRTLPPGTGALSGGVMASIIFGVLLFIGLLLGILFFRRKKAHRRQARP 1790

Query: 456  SVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVL-IPEQQFTLGRML 514
                 G           F+RE+   ++  +D     D  +  LE +  +     T+  ++
Sbjct: 1791 DYSTSG-----------FDREKVW-LKPYVDLQPYDDPSRGVLEFIKELDVSCVTMENVI 1934

Query: 515  GKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLV 574
            G+GEFG V    L+      + VA+K LK+   + S    FLREA  M +F+HP++  L 
Sbjct: 1935 GEGEFGEVYRGSLRLPGKERIVVAIKTLKSTY-SDSQWWNFLREATIMGQFNHPNIVHLE 2111

Query: 575  GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGME 634
            GV  + R        M+I  +M++G L  FL   R  E  F+ P+Q LV  +  IA GM 
Sbjct: 2112 GVVTKRRPM------MIITEYMENGALDTFL---RENEEKFS-PVQ-LVNMLQGIASGMT 2258

Query: 635  YLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYS---GDYYRQGCASKLPVKWLAL 691
            YLS  N++HRDLAARN ++   +   V+DFGLSR + +   G Y  +G   K+P++W A 
Sbjct: 2259 YLSEHNYVHRDLAARNILVTRSLQCKVSDFGLSRILENDAEGTYETKG--GKIPIRWTAP 2432

Query: 692  ESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEV 751
            E++A  ++T  SDVW+FG+ MWE+++ G  PY  + N E+   L  G RL  P +C   +
Sbjct: 2433 EAIAHRIFTSASDVWSFGIVMWEVLSFGDKPYGNMTNQEVMKSLEDGYRLPPPVDCPSIL 2612

Query: 752  YDLMYQCWSADPKQRPSFTCLRMELEN 778
            Y+LM  CWS D  +RP F  +R +L++
Sbjct: 2613 YELMKSCWSHDRMRRPHFQEIRAQLQH 2693
>ref|NM_007982.1| Mus musculus PTK2 protein tyrosine kinase 2 (Ptk2), mRNA
          Length = 4211

 Score =  200 bits (508), Expect = 6e-49
 Identities = 104/281 (37%), Positives = 163/281 (57%)
 Frame = +2

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I  ++  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1349 DYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCK-NCTSDSVREKFLQEA 1525

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1526 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1669

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++ +  V + DFGLSR +    YY+  
Sbjct: 1670 ASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKAS 1849

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 1850 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE 2026

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2027 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2149
>gb|M95408.1|MUSFAK Mouse focal adhesion kinase mRNA, complete cds
          Length = 4211

 Score =  200 bits (508), Expect = 6e-49
 Identities = 104/281 (37%), Positives = 163/281 (57%)
 Frame = +2

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I  ++  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1349 DYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCK-NCTSDSVREKFLQEA 1525

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1526 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1669

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++ +  V + DFGLSR +    YY+  
Sbjct: 1670 ASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKAS 1849

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 1850 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE 2026

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2027 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2149
>gb|S53216.1|S53216 vik=variant in the kinase [mice, mRNA, 2968 nt]
          Length = 2968

 Score =  200 bits (508), Expect = 6e-49
 Identities = 111/285 (38%), Positives = 162/285 (55%), Gaps = 8/285 (2%)
 Frame = +3

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGS------VREAQLKQEDGSFVKVAVKMLKADI 546
            E K K++D+ I  ++ TL  +L +G FG       V E    +E  +FVK        D 
Sbjct: 1524 EAKAKVKDIAISRERITLKDVLQEGTFGRIFHGILVDEKDPNKEKQTFVKTV-----KDQ 1688

Query: 547  IASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLL 606
             +   +   L E+  ++   H ++  +  V +    K     PMV+LP+M  G+L  FL 
Sbjct: 1689 ASEVQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVVLPYMNWGNLKLFLR 1853

Query: 607  ASRIGE--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADF 664
              ++ E  NP  +  Q LV   + IACGM YL+ R  IHRDLAARNC++ + + V + D 
Sbjct: 1854 QCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHRDLAARNCVIDDTLQVKITDN 2033

Query: 665  GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
             LSR ++  DY+ QG     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY 
Sbjct: 2034 ALSRDLFPMDYHCQGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYV 2213

Query: 725  GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             I+  E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 2214 DIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 2348
>gb|AF020777.1|AF020777 Rattus norvegicus focal adhesion kinase (FAK) mRNA, alternatively
            spliced, complete cds
          Length = 4541

 Score =  200 bits (508), Expect = 6e-49
 Identities = 104/281 (37%), Positives = 163/281 (57%)
 Frame = +3

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I  ++  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1671 DYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCK-NCTSDSVREKFLQEA 1847

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1848 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1991

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++ +  V + DFGLSR +    YY+  
Sbjct: 1992 ASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKAS 2171

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 2172 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE 2348

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2349 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2471
>ref|NM_013081.1| Rattus norvegicus Protein tyrosine kinase (Ptk2), mRNA
          Length = 4541

 Score =  200 bits (508), Expect = 6e-49
 Identities = 104/281 (37%), Positives = 163/281 (57%)
 Frame = +3

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I  ++  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1671 DYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCK-NCTSDSVREKFLQEA 1847

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1848 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1991

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++ +  V + DFGLSR +    YY+  
Sbjct: 1992 ASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKAS 2171

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 2172 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE 2348

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2349 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2471
>gb|L13616.1|HUMFAKX Human focal adhesion kinase (FAK) mRNA, complete cds
          Length = 3791

 Score =  200 bits (508), Expect = 6e-49
 Identities = 104/281 (37%), Positives = 163/281 (57%)
 Frame = +2

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I  ++  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1472 DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCK-NCTSDSVREKFLQEA 1648

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1649 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1792

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++ +  V + DFGLSR +    YY+  
Sbjct: 1793 ASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKAS 1972

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 1973 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE 2149

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2150 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2272
>gb|M86656.1|CHKFAK Chicken focal adhesion molecule (FAK) mRNA, complete cds
          Length = 3211

 Score =  200 bits (508), Expect = 6e-49
 Identities = 105/281 (37%), Positives = 162/281 (57%)
 Frame = +2

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I  ++  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1289 DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCK-NCTSDSVREKFLQEA 1465

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     F+L L
Sbjct: 1466 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----FSLDL 1609

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++    V + DFGLSR +    YY+  
Sbjct: 1610 ASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYMEDSTYYKAS 1789

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 1790 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGE 1966

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 1967 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2089
>emb|X06770.1|GGROSCR Chicken c-ros mRNA
          Length = 1974

 Score =  200 bits (508), Expect = 6e-49
 Identities = 103/234 (44%), Positives = 145/234 (61%), Gaps = 9/234 (3%)
 Frame = +1

Query: 555 FLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP 614
           FL+EA  M +FDHPH+ KL+GV L +  +       +IL  M+ GDL ++L  +R  +  
Sbjct: 1   FLKEAHLMSKFDHPHILKLLGVCLLNEPQ------YLILELMEGGDLLSYLRGAR--KQK 156

Query: 615 FNLPLQTLVRFM---VDIACGMEYLSSRNFIHRDLAARNCMLAEDM------TVCVADFG 665
           F  PL TL   +   +DI  G  YL    FIHRDLAARNC+++E         V + DFG
Sbjct: 157 FQSPLLTLTDLLDICLDICKGCVYLEKMRFIHRDLAARNCLVSEKQYGSCSRVVKIGDFG 336

Query: 666 LSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAG 725
           L+R IY  DYYR+     LPV+W+A ESL D ++T HSDVWAFGV +WE +T GQ PY G
Sbjct: 337 LARDIYKNDYYRKRGEGLLPVRWMAPESLIDGVFTNHSDVWAFGVLVWETLTLGQQPYPG 516

Query: 726 IENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENI 779
           + N E+ +++  G RL+ P  C +++ DLM +CW+ DP  RP+F  ++ +L+ I
Sbjct: 517 LSNIEVLHHVRSGGRLESPNNCPDDIRDLMTRCWAQDPHNRPTFFYIQHKLQEI 678
>ref|NM_023580.1| Mus musculus RIKEN cDNA 5730453L17 gene (5730453L17Rik), mRNA
          Length = 2934

 Score =  199 bits (507), Expect = 8e-49
 Identities = 176/616 (28%), Positives = 274/616 (43%), Gaps = 28/616 (4%)
 Frame = +1

Query: 193  CEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVP-----GADGLALLHS 247
            C   N    A      V    PP+AP N + +T S    S+ W P     G   +     
Sbjct: 934  CTCENGHYRAPGEGPQVACTRPPSAPQNLSFST-SGTQLSLRWEPPRDTGGRHDIRYSVE 1110

Query: 248  CTV--QVAHAPGEWEALAVVVPVPPF-------TCLLRNLAPATNYSLRVRCANALG--- 295
            C     +A   G  +     V   P        T  ++ L P  NY+  V+  N +    
Sbjct: 1111 CLQCRGIAQDGGPCQPCGKGVHFSPAASGLTTSTVQVQGLEPYANYTFTVKSQNRVSGLD 1290

Query: 296  -PSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG-LILEWEEVIPEDPGEGPLGPYKLSWV 353
              SP    +     G A + +  +   ++ +   L L W    P +PG G L  Y+L  +
Sbjct: 1291 SSSPSSASLSINM-GHAESLSGLSLKLVKKEPRQLELTWAGSRPRNPG-GNLS-YELHVL 1461

Query: 354  QENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPP 413
             ++    ++++E  R  LT   P    I+RV     +G GP+S        DH  R  PP
Sbjct: 1462 NQDEEWHQMVLE-PRVLLTKLQPDTTYIVRVRTLTPLGPGPFSP-------DHEFRTSPP 1617

Query: 414  HSRT----SWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRA 469
             SR+      V V+ G+               R+ +++ +  Q                 
Sbjct: 1618 VSRSLTGGEIVAVIFGLLLGIALLIGIYVFRSRRGQRQRQQRQR---------------- 1749

Query: 470  ARSFNRERPERI--EATLDSLGISDELKEKLEDVL-IPEQQFTLGRMLGKGEFGSVREAQ 526
             R+ N +R +++  +  +D     D  +  L+    +      +  ++G+GEFG V    
Sbjct: 1750 ERTTNVDREDKLWLKPYVDLQAYEDPAQGALDFAQELDPAWLIVDTVIGEGEFGEVYRGA 1929

Query: 527  LKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL 586
            L+        VA+K LK D         FLREA  M +F+HPH+ +L GV  +     R 
Sbjct: 1930 LRLPSQDCKTVAIKTLK-DTSPDGYWWNFLREATIMGQFNHPHILRLEGVITK-----RK 2091

Query: 587  PIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDL 646
            PI M+I  FM++G L AFL      E    L    LV  ++ IA GM  LS  N++HRDL
Sbjct: 2092 PI-MIITEFMENGALDAFLK-----EREDQLAPGQLVAMLLGIASGMNCLSGHNYVHRDL 2253

Query: 647  AARNCMLAEDMTVCVADFGLSRKI--YSGDYYRQGCASKLPVKWLALESLADNLYTVHSD 704
            AARN ++ +++   V+DFGL+R +  + G Y  QG   K+P++W A E++A  ++T  SD
Sbjct: 2254 AARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQG--GKIPIRWTAPEAIAHRIFTTASD 2427

Query: 705  VWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPK 764
            VW+FG+  WE+++ G  PY  + N E+   +  G RL  P +C   +Y+LM  CW+ D  
Sbjct: 2428 VWSFGIVTWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDRA 2607

Query: 765  QRPSFTCLRMELENIL 780
            +RP F  L+  LE +L
Sbjct: 2608 RRPHFLQLQAHLEQLL 2655
>gb|AF131197.1|AF131197 Mus musculus receptor tyrosine kinase EphA1 mRNA, complete cds
          Length = 2934

 Score =  199 bits (507), Expect = 8e-49
 Identities = 176/616 (28%), Positives = 274/616 (43%), Gaps = 28/616 (4%)
 Frame = +1

Query: 193  CEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVP-----GADGLALLHS 247
            C   N    A      V    PP+AP N + +T S    S+ W P     G   +     
Sbjct: 934  CTCENGHYRAPGEGPQVACTRPPSAPQNLSFST-SGTQLSLRWEPPRDTGGRHDIRYSVE 1110

Query: 248  CTV--QVAHAPGEWEALAVVVPVPPF-------TCLLRNLAPATNYSLRVRCANALG--- 295
            C     +A   G  +     V   P        T  ++ L P  NY+  V+  N +    
Sbjct: 1111 CLQCRGIAQDGGPCQPCGKGVHFSPAASGLTTSTVQVQGLEPYANYTFTVKSQNRVSGLD 1290

Query: 296  -PSPYGDWVPFQTKGLAPARAPQNFHAIRTDSG-LILEWEEVIPEDPGEGPLGPYKLSWV 353
              SP    +     G A + +  +   ++ +   L L W    P +PG G L  Y+L  +
Sbjct: 1291 SSSPSSASLSINM-GHAESLSGLSLKLVKKEPRQLELTWAGSRPRNPG-GNLS-YELHVL 1461

Query: 354  QENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPP 413
             ++    ++++E  R  LT   P    I+RV     +G GP+S        DH  R  PP
Sbjct: 1462 NQDEEWHQMVLE-PRVLLTKLQPDTTYIVRVRTLTPLGPGPFSP-------DHEFRTSPP 1617

Query: 414  HSRT----SWVPVVLGVXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRA 469
             SR+      V V+ G+               R+ +++ +  Q                 
Sbjct: 1618 VSRSLTGGEIVAVIFGLLLGIALLIGIYVFRSRRGQRQRQQRQR---------------- 1749

Query: 470  ARSFNRERPERI--EATLDSLGISDELKEKLEDVL-IPEQQFTLGRMLGKGEFGSVREAQ 526
             R+ N +R +++  +  +D     D  +  L+    +      +  ++G+GEFG V    
Sbjct: 1750 ERTTNVDREDKLWLKPYVDLQAYEDPAQGALDFAQELDPAWLIVDTVIGEGEFGEVYRGA 1929

Query: 527  LKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL 586
            L+        VA+K LK D         FLREA  M +F+HPH+ +L GV  +     R 
Sbjct: 1930 LRLPSQDCKTVAIKTLK-DTSPDGYWWNFLREATIMGQFNHPHILRLEGVITK-----RK 2091

Query: 587  PIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDL 646
            PI M+I  FM++G L AFL      E    L    LV  ++ IA GM  LS  N++HRDL
Sbjct: 2092 PI-MIITEFMENGALDAFLK-----EREDQLAPGQLVAMLLGIASGMNCLSGHNYVHRDL 2253

Query: 647  AARNCMLAEDMTVCVADFGLSRKI--YSGDYYRQGCASKLPVKWLALESLADNLYTVHSD 704
            AARN ++ +++   V+DFGL+R +  + G Y  QG   K+P++W A E++A  ++T  SD
Sbjct: 2254 AARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQG--GKIPIRWTAPEAIAHRIFTTASD 2427

Query: 705  VWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPK 764
            VW+FG+  WE+++ G  PY  + N E+   +  G RL  P +C   +Y+LM  CW+ D  
Sbjct: 2428 VWSFGIVTWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDRA 2607

Query: 765  QRPSFTCLRMELENIL 780
            +RP F  L+  LE +L
Sbjct: 2608 RRPHFLQLQAHLEQLL 2655
>ref|NM_007439.1| Mus musculus anaplastic lymphoma kinase (Alk), mRNA
          Length = 5767

 Score =  199 bits (507), Expect = 8e-49
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 3793 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 3969

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL++  +       ++L  M  GDL +FL  +R   N P +L +
Sbjct: 3970 IISKFNHQNIVRCIGVSLQALPR------FILLELMAGGDLKSFLRETRPRPNQPTSLAM 4131

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 4132 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGAGRIAKIGDFGMARDIYRASYY 4311

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 4312 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 4491

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 4492 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 4671

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 4672 VVEEEEKVPMRPKDPE 4719
>dbj|D83002.1|D83002 Mouse mRNA for tyrosine kinase, complete cds
          Length = 5767

 Score =  199 bits (507), Expect = 8e-49
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 3793 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 3969

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL++  +       ++L  M  GDL +FL  +R   N P +L +
Sbjct: 3970 IISKFNHQNIVRCIGVSLQALPR------FILLELMAGGDLKSFLRETRPRPNQPTSLAM 4131

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 4132 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGAGRIAKIGDFGMARDIYRASYY 4311

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 4312 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 4491

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 4492 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 4671

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 4672 VVEEEEKVPMRPKDPE 4719
>ref|XM_055726.2| Homo sapiens anaplastic lymphoma kinase (Ki-1) (ALK), mRNA
          Length = 4033

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 2051 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 2227

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 2228 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 2389

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 2390 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 2569

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 2570 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 2749

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 2750 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 2929

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 2930 LVEEEEKVPVRPKDPE 2977
>ref|NM_005158.2| Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 2
            (arg, Abelson-related gene) (ABL2), transcript variant a,
            mRNA
          Length = 3543

 Score =  199 bits (506), Expect = 1e-48
 Identities = 113/277 (40%), Positives = 159/277 (56%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V     K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 763  TMKHKLGGGQYGEVYVGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 924

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV          P   ++  +M +G+L  +L       N   +    L+     
Sbjct: 925  NLVQLLGVCTLE------PPFYIVTEYMPYGNLLDYLREC----NREEVTAVVLLYMATQ 1074

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1075 ISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1251

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y+ L  G R++QP  C 
Sbjct: 1252 TAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCP 1431

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
             +VY+LM  CW   P  RPSF       E +    S+
Sbjct: 1432 PKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSI 1542
>gb|AF125093.1|AF125093 Homo sapiens TRK-fused gene-anaplastic lymphoma kinase fusion
           protein (TFG/ALK) mRNA, complete cds
          Length = 2614

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +3

Query: 503 IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
           +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 630 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 806

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
            + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 807 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 968

Query: 620 QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
             L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 969 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 1148

Query: 677 RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
           R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 1149RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 1328

Query: 737 GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
            G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 1329SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 1508

Query: 797 IERAEQ--PTESGSPE 810
           +   E+  P     PE
Sbjct: 1509LVEEEEKVPVRPKDPE 1556
>gb|U04946.1|HSU04946 Human nucleophosmin-anaplastic lymphoma kinase fusion protein
           (NPM/ALK)  mRNA, complete cds
          Length = 2043

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +1

Query: 503 IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
           +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 511 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 687

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
            + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 688 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 849

Query: 620 QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
             L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 850 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 1029

Query: 677 RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
           R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 1030RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 1209

Query: 737 GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
            G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 1210SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 1389

Query: 797 IERAEQ--PTESGSPE 810
           +   E+  P     PE
Sbjct: 1390LVEEEEKVPVRPKDPE 1437
>ref|NM_004304.2| Homo sapiens anaplastic lymphoma kinase (Ki-1) (ALK), mRNA
          Length = 6989

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 4242 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 4418

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 4419 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 4580

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 4581 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 4760

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 4761 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 4940

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 4941 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 5120

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 5121 LVEEEEKVPVRPKDPE 5168
>gb|U66559.1|HSU66559 Human anaplastic lymphoma kinase receptor mRNA, complete cds
          Length = 5293

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 3479 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 3655

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 3656 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 3817

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 3818 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 3997

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 3998 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 4177

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 4178 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 4357

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 4358 LVEEEEKVPVRPKDPE 4405
>ref|NM_007314.1| Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 2
            (arg, Abelson-related gene) (ABL2), transcript variant b,
            mRNA
          Length = 3849

 Score =  199 bits (506), Expect = 1e-48
 Identities = 113/277 (40%), Positives = 159/277 (56%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V     K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 1069 TMKHKLGGGQYGEVYVGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 1230

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV          P   ++  +M +G+L  +L       N   +    L+     
Sbjct: 1231 NLVQLLGVCTLE------PPFYIVTEYMPYGNLLDYLREC----NREEVTAVVLLYMATQ 1380

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1381 ISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1557

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y+ L  G R++QP  C 
Sbjct: 1558 TAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCP 1737

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
             +VY+LM  CW   P  RPSF       E +    S+
Sbjct: 1738 PKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSI 1848
>gb|M35296.1|HUMARGCAA Human tyrosine kinase arg gene mRNA
          Length = 3849

 Score =  199 bits (506), Expect = 1e-48
 Identities = 113/277 (40%), Positives = 159/277 (56%)
 Frame = +1

Query: 509  TLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHP 568
            T+   LG G++G V     K+     + VAVK LK D +   ++EEFL+EAA MKE  HP
Sbjct: 1069 TMKHKLGGGQYGEVYVGVWKKYS---LTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHP 1230

Query: 569  HVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVD 628
            ++ +L+GV          P   ++  +M +G+L  +L       N   +    L+     
Sbjct: 1231 NLVQLLGVCTLE------PPFYIVTEYMPYGNLLDYLREC----NREEVTAVVLLYMATQ 1380

Query: 629  IACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKW 688
            I+  MEYL  +NFIHRDLAARNC++ E+  V VADFGLSR + +GD Y     +K P+KW
Sbjct: 1381 ISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSR-LMTGDTYTAHAGAKFPIKW 1557

Query: 689  LALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECM 748
             A ESLA N +++ SDVWAFGV +WEI T G +PY GI+ +++Y+ L  G R++QP  C 
Sbjct: 1558 TAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCP 1737

Query: 749  EEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSV 785
             +VY+LM  CW   P  RPSF       E +    S+
Sbjct: 1738 PKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSI 1848
>dbj|D45915.1|D45915 Human mRNA for p80 protein, complete cds
          Length = 2584

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +3

Query: 503 IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
           +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 600 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 776

Query: 561 CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
            + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 777 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 938

Query: 620 QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
             L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 939 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 1118

Query: 677 RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
           R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 1119RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 1298

Query: 737 GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
            G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 1299SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 1478

Query: 797 IERAEQ--PTESGSPE 810
           +   E+  P     PE
Sbjct: 1479LVEEEEKVPVRPKDPE 1526
>gb|U62540.1|HSU62540 Human anaplastic lymphoma kinase (ALK) mRNA, complete cds
          Length = 6226

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 4242 VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 4418

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 4419 IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 4580

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 4581 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 4760

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 4761 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 4940

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 4941 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 5120

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 5121 LVEEEEKVPVRPKDPE 5168
>gb|U23783.1|GGU23783 Gallus gallus embryo kinase 9 protein (Cek9) mRNA, complete cds
          Length = 3712

 Score =  199 bits (506), Expect = 1e-48
 Identities = 158/548 (28%), Positives = 245/548 (43%), Gaps = 15/548 (2%)
 Frame = +1

Query: 277  NLAPATNYSLRVRCANAL----GPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEW 332
            NL     Y+  ++  N +      +P    +   T    P+  P      R  S + L W
Sbjct: 1381 NLLARVQYTFEIQAVNLVTELSSEAPQYATINVSTSQSVPSAIPMMHQVSRATSSITLSW 1560

Query: 333  EEVIPEDPGEGPLGPYKLSWVQENGTQDE---LMVEGTRANLTDWDPQKDLILRVCASNA 389
             +  P+ P  G +  Y+L +  +   +D    L  E   A + +  P K  + +V A  A
Sbjct: 1561 PQ--PDQPN-GVILDYQLRYFDKAEDEDNSFTLTSETNMATILNLSPGKIYVFQVRARTA 1731

Query: 390  IGDGPWS-----QPLVVSSHDHAGRQGPPHSRTSWVPVVLGVXXXXXXXXXXXXXXXRKR 444
            +G GP+S     Q L+   H    +   P    S    + G+               + +
Sbjct: 1732 VGYGPYSGKMYFQTLMAGEHSEMAQDRLPLIVGS---ALGGLAFLVIAAIAILAIIFKSK 1902

Query: 445  RKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIP 504
            R+ET +       ++     V +    S   +  E I      + +S     K+E+V+  
Sbjct: 1903 RRETPYTDRLQQYISTRGLGVKYYIDPSTYEDPNEAIREFAKEIDVSFI---KIEEVI-- 2067

Query: 505  EQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKE 564
                      G GEFG V   +LK        VA+K LK+         EFL EA+ M +
Sbjct: 2068 ----------GSGEFGEVCFGRLKHPGKREYTVAIKTLKSGY-TDEQRREFLSEASIMGQ 2214

Query: 565  FDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVR 624
            F+HP+V  L GV  +SR     P+ M++  FM++G L +FL   R  E  F++ LQ LV 
Sbjct: 2215 FEHPNVIHLEGVVTKSR-----PV-MIVTEFMENGSLDSFL---RQKEGQFSV-LQ-LVG 2361

Query: 625  FMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY---SGDYYRQGCA 681
             +  IA GM YLS  N++HRDLAARN ++  ++   V+DFGLSR +    S   Y     
Sbjct: 2362 MLRGIAAGMRYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDASNPTYTGALG 2541

Query: 682  SKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRL 741
             K+P++W A E++    +T  SDVW++G+ MWE+M+ G+ PY  + N ++ N +    RL
Sbjct: 2542 CKIPIRWTAPEAVQYRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIDQDYRL 2721

Query: 742  KQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINIERAE 801
              PP+C   ++ LM  CW  D  QRP F  +   L+ ++   S L  +         R  
Sbjct: 2722 PPPPDCPTVLHLLMLDCWQKDRVQRPKFEQIVSALDKMIRKPSALKATG----TGSSRPS 2889

Query: 802  QPTESGSP 809
            QP  S SP
Sbjct: 2890 QPLLSNSP 2913
>gb|AF143407.1|AF143407 Homo sapiens TRK-fused gene/anaplastic lymphoma kinase (Ki-1) fusion
            protein long form (TFG/ALK fusion) mRNA, complete cds
          Length = 2779

 Score =  199 bits (506), Expect = 1e-48
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 8/316 (2%)
 Frame = +3

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLK--QEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P +  TL R LG G FG V E Q+     D S ++VAVK L  ++ +  D  +FL EA 
Sbjct: 795  VPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLP-EVCSEQDELDFLMEAL 971

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGEN-PFNLPL 619
             + +F+H ++ + +GVSL+S  +       ++L  M  GDL +FL  +R   + P +L +
Sbjct: 972  IISKFNHQNIVRCIGVSLQSLPR------FILLELMAGGDLKSFLRETRPRPSQPSSLAM 1133

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA---EDMTVCVADFGLSRKIYSGDYY 676
              L+    DIACG +YL   +FIHRD+AARNC+L          + DFG++R IY   YY
Sbjct: 1134 LDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYY 1313

Query: 677  RQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLI 736
            R+G  + LPVKW+  E+  + ++T  +D W+FGV +WEI + G  PY    N E+  ++ 
Sbjct: 1314 RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVT 1493

Query: 737  GGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYIN 796
             G R+  P  C   VY +M QCW   P+ RP+F  +   +E       V++T+    Y  
Sbjct: 1494 SGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGP 1673

Query: 797  IERAEQ--PTESGSPE 810
            +   E+  P     PE
Sbjct: 1674 LVEEEEKVPVRPKDPE 1721
>ref|NM_005424.1| Homo sapiens tyrosine kinase with immunoglobulin and epidermal growth
            factor homology domains (TIE), mRNA
          Length = 3845

 Score =  199 bits (505), Expect = 1e-48
 Identities = 214/786 (27%), Positives = 341/786 (43%), Gaps = 56/786 (7%)
 Frame = +1

Query: 51   KLNCSVEGMEDP---DIHWMK-DGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYW 106
            ++NC+  G   P    I   K DGTV+ +   +   +          +  +  +D+G + 
Sbjct: 1141 RINCAAAGNPFPVRGSIELRKPDGTVLLSTKAI---VEPEKTTAEFEVPRLVLADSGFWE 1311

Query: 107  CQV-----KDGEETKISQSVWLTVEGVP-FFTVEPKDLAVPPNAPFQLSCEAVGP----- 155
            C+V     +D    K++  V       P   T + + L V P   F       GP     
Sbjct: 1312 CRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFS----GDGPISTVR 1479

Query: 156  ----PEPVTIYWWRGLTKVGGPAPSPSVLNV---TGVTQRTEFSCEARNIKGLATSRPAI 208
                P+  T+ W    T V  P+ + +++N+   TG + R + S      +G A   P +
Sbjct: 1480 LHYRPQDSTMDW---STIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEG-AWGPPTL 1647

Query: 209  VRLQAPPAA--PFNTTVTTISSYNASVAW-VPGADGLALLHSCTVQVAHAPGEWEALAVV 265
            +    P     P+        +    V+W +P   G  +     +++       E    V
Sbjct: 1648 MTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENV 1827

Query: 266  VPVPPFTCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-I 322
                  T LL  L P T+Y L V+  +   LGP+     V     G     AP++ HA  
Sbjct: 1828 SSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG---PPAPRHLHAQA 1998

Query: 323  RTDSGLILEWE--EVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDW-----D 375
             +DS + L W+  E +P     GP+  Y +      G  D L ++  R   T       +
Sbjct: 1999 LSDSEIQLTWKHPEALP-----GPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLN 2163

Query: 376  PQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGR-QGP-PHSRTSW--------VPVVLG 425
                 + R+ AS   G G WS  +  S+  +  + +GP   SR +         + VV  
Sbjct: 2164 ASTRYLFRMRASIQ-GLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGS 2340

Query: 426  VXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATL 485
            V                 RR      + F      GE  +   ++ +    R  +++   
Sbjct: 2341 VSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQP-- 2514

Query: 486  DSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKAD 545
                      E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +
Sbjct: 2515 ----------EPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-E 2658

Query: 546  IIASSDIEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAF 604
              + +D  +F  E   + K   HP++  L+G     + +G L I +   P+   G+L  F
Sbjct: 2659 YASENDHRDFAGELEVLCKLGHHPNIINLLGAC---KNRGYLYIAIEYAPY---GNLLDF 2820

Query: 605  LLASRIGENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA 654
            L  SR+ E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ 
Sbjct: 2821 LRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVG 3000

Query: 655  EDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWE 714
            E++   +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WE
Sbjct: 3001 ENLASKIADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWE 3171

Query: 715  IMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRM 774
            I++ G TPY G+  AE+Y  L  G R++QP  C +EVY+LM QCW   P +RP F  + +
Sbjct: 3172 IVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIAL 3351

Query: 775  ELENIL 780
            +L  +L
Sbjct: 3352 QLGRML 3369
>emb|X60957.1|HSTIEMR Human tie mRNA for putative receptor tyrosine kinase
          Length = 3845

 Score =  199 bits (505), Expect = 1e-48
 Identities = 214/786 (27%), Positives = 341/786 (43%), Gaps = 56/786 (7%)
 Frame = +1

Query: 51   KLNCSVEGMEDP---DIHWMK-DGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYW 106
            ++NC+  G   P    I   K DGTV+ +   +   +          +  +  +D+G + 
Sbjct: 1141 RINCAAAGNPFPVRGSIELRKPDGTVLLSTKAI---VEPEKTTAEFEVPRLVLADSGFWE 1311

Query: 107  CQV-----KDGEETKISQSVWLTVEGVP-FFTVEPKDLAVPPNAPFQLSCEAVGP----- 155
            C+V     +D    K++  V       P   T + + L V P   F       GP     
Sbjct: 1312 CRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFS----GDGPISTVR 1479

Query: 156  ----PEPVTIYWWRGLTKVGGPAPSPSVLNV---TGVTQRTEFSCEARNIKGLATSRPAI 208
                P+  T+ W    T V  P+ + +++N+   TG + R + S      +G A   P +
Sbjct: 1480 LHYRPQDSTMDW---STIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEG-AWGPPTL 1647

Query: 209  VRLQAPPAA--PFNTTVTTISSYNASVAW-VPGADGLALLHSCTVQVAHAPGEWEALAVV 265
            +    P     P+        +    V+W +P   G  +     +++       E    V
Sbjct: 1648 MTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENV 1827

Query: 266  VPVPPFTCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-I 322
                  T LL  L P T+Y L V+  +   LGP+     V     G     AP++ HA  
Sbjct: 1828 SSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG---PPAPRHLHAQA 1998

Query: 323  RTDSGLILEWE--EVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDW-----D 375
             +DS + L W+  E +P     GP+  Y +      G  D L ++  R   T       +
Sbjct: 1999 LSDSEIQLTWKHPEALP-----GPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLN 2163

Query: 376  PQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGR-QGP-PHSRTSW--------VPVVLG 425
                 + R+ AS   G G WS  +  S+  +  + +GP   SR +         + VV  
Sbjct: 2164 ASTRYLFRMRASIQ-GLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGS 2340

Query: 426  VXXXXXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATL 485
            V                 RR      + F      GE  +   ++ +    R  +++   
Sbjct: 2341 VSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQP-- 2514

Query: 486  DSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKAD 545
                      E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +
Sbjct: 2515 ----------EPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-E 2658

Query: 546  IIASSDIEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAF 604
              + +D  +F  E   + K   HP++  L+G     + +G L I +   P+   G+L  F
Sbjct: 2659 YASENDHRDFAGELEVLCKLGHHPNIINLLGAC---KNRGYLYIAIEYAPY---GNLLDF 2820

Query: 605  LLASRIGENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA 654
            L  SR+ E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ 
Sbjct: 2821 LRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVG 3000

Query: 655  EDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWE 714
            E++   +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WE
Sbjct: 3001 ENLASKIADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWE 3171

Query: 715  IMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRM 774
            I++ G TPY G+  AE+Y  L  G R++QP  C +EVY+LM QCW   P +RP F  + +
Sbjct: 3172 IVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIAL 3351

Query: 775  ELENIL 780
            +L  +L
Sbjct: 3352 QLGRML 3369
>gb|U11078.1|XLU11078 Xenopus laevis focal adhesion kinase pp125FAK mRNA, complete cds
          Length = 4248

 Score =  198 bits (504), Expect = 2e-48
 Identities = 104/281 (37%), Positives = 161/281 (57%)
 Frame = +2

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I   +  LGR +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1442 DYEIQRDRIELGRCIGEGQFGDVHQGVYMSPENPAMAVAIKTCK-NCTSDSVREKFLQEA 1618

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1619 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1762

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++    V + DFGLSR +    YY+  
Sbjct: 1763 ASLILYSYQLSTALAYLESKRFVHRDIAARNVLVSSSDCVKLGDFGLSRYMEDSTYYKAS 1942

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 1943 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGVKPFQGVKNNDVIGRIENGE 2119

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2120 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2242
>gb|S83394.1|S83394 insulin-like peptide receptor [Branchiostoma lanceolatum=amphioxus,
            mRNA, 4974 nt]
          Length = 4974

 Score =  198 bits (503), Expect = 2e-48
 Identities = 126/373 (33%), Positives = 185/373 (48%), Gaps = 25/373 (6%)
 Frame = +2

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            +P ++ TL R LG+G FG V E + K   +D   V VAVK +         IE FL EA+
Sbjct: 3374 VPREKITLIRELGQGSFGMVYEGEAKDVVKDEPMVSVAVKTVNESASIRERIE-FLNEAS 3550

Query: 561  CMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR----------- 609
             MK F+  HV KL+GV  + +        +V++  M  GDL  +L   R           
Sbjct: 3551 VMKTFNCHHVVKLMGVVSKGQPT------LVVMELMALGDLKNYLRRHRPEEDVGLSDSP 3712

Query: 610  ---------IGENPFNLP--LQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMT 658
                       EN  +LP   + +++    IA GM YL+++ F+HRDLA RNCM+A+D T
Sbjct: 3713 ASNEAKNSPFAENDNDLPPTFKDIIQMAGVIADGMSYLAAKKFVHRDLACRNCMVAQDRT 3892

Query: 659  VCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTR 718
            V + DFG++R IY  DYYR+G    LPV+W++ ESL   ++T  SDVW++GV +WE+ T 
Sbjct: 3893 VKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKVGVFTSQSDVWSYGVVLWEMATL 4072

Query: 719  GQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELEN 778
               PY G  N E+  ++I G  L++P  C  ++YDLM  CW      RP+F    +E+  
Sbjct: 4073 ASQPYQGKSNEEVLKFVIDGGMLEKPEGCPNKLYDLMKLCWQYRQSMRPTF----LEIVE 4240

Query: 779  ILGHLSVLSTSQDPLYINIE-RAEQPTESGSPELHCGERXXXXXXXXXXXXXXXXIPSDS 837
            IL        ++   Y +++    +P E     L  G                   PS S
Sbjct: 4241 ILSPELQAHFNEVSFYHSLDNHGREPLEMDDVALDSG-----------ADTETEMYPSGS 4387

Query: 838  RYIFSPGGLSESP 850
             +  +P   SE+P
Sbjct: 4388 EFSSTPSPPSETP 4426
>ref|NM_013690.1| Mus musculus endothelial-specific receptor tyrosine kinase (Tek),
            mRNA
          Length = 4676

 Score =  197 bits (502), Expect = 3e-48
 Identities = 172/570 (30%), Positives = 264/570 (46%), Gaps = 26/570 (4%)
 Frame = +1

Query: 264  VVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVP----FQTKGLAPARAPQNF 319
            + VP    + LL NL P   Y++R R    +     G+W      +    + P + P+N 
Sbjct: 2122 IKVPGNLTSVLLSNLVPREQYTVRAR----VNTKAQGEWSEELRAWTLSDILPPQ-PENI 2286

Query: 320  HAIR-TDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGT--RANLTDWDP 376
                 TDS  ++ W  ++        +  YK+    E+   D  +   T  +  L   +P
Sbjct: 2287 KISNITDSTAMVSWT-IVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEP 2463

Query: 377  QKDLILRVCASNAIGDG--PWSQPLVVSSH-----DHAGRQGPPHSRTSWVPVVLGVXXX 429
            +    + + A N IG     +S  L    H     D  G +   HS   WV         
Sbjct: 2464 ETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASADLGGGKDATHSHP-WVG--WNDFAS 2634

Query: 430  XXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSL 488
                        ++   + R  QAF +V  R EPAV F +   + NR+     + T+   
Sbjct: 2635 PCLLAFLIMLQLKRANVQRRMAQAFQNV--REEPAVQFNSGTLALNRKAKNNPDPTI--Y 2802

Query: 489  GISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIA 548
             + D    K +DV+            G+G FG V +A++K+ DG  +  A+K +K +  +
Sbjct: 2803 PVLDWNDIKFQDVI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYAS 2940

Query: 549  SSDIEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
              D  +F  E   + K   HP++  L+G       +G L + +   P   HG+L  FL  
Sbjct: 2941 KDDHRDFAGELEVLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLGK 3102

Query: 608  SRIGENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDM 657
            SR+ E              L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+ 
Sbjct: 3103 SRVLETDPAFCHRQQYSSTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENY 3282

Query: 658  TVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMT 717
               +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++
Sbjct: 3283 IAKIADFGLSR---GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVS 3453

Query: 718  RGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
             G TPY G+  AE+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L 
Sbjct: 3454 LGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLN 3633

Query: 778  NILGHLSVLSTSQDPLYINIERAEQPTESG 807
             +L         +   Y+N    E+ T +G
Sbjct: 3634 RML--------EERKTYVNTTLYEKFTYAG 3699
>dbj|D13738.1|MUSHYK Mouse mRNA for receptor tyrosine kinase, complete cds
          Length = 4676

 Score =  197 bits (502), Expect = 3e-48
 Identities = 172/570 (30%), Positives = 264/570 (46%), Gaps = 26/570 (4%)
 Frame = +1

Query: 264  VVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVP----FQTKGLAPARAPQNF 319
            + VP    + LL NL P   Y++R R    +     G+W      +    + P + P+N 
Sbjct: 2122 IKVPGNLTSVLLSNLVPREQYTVRAR----VNTKAQGEWSEELRAWTLSDILPPQ-PENI 2286

Query: 320  HAIR-TDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGT--RANLTDWDP 376
                 TDS  ++ W  ++        +  YK+    E+   D  +   T  +  L   +P
Sbjct: 2287 KISNITDSTAMVSWT-IVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEP 2463

Query: 377  QKDLILRVCASNAIGDG--PWSQPLVVSSH-----DHAGRQGPPHSRTSWVPVVLGVXXX 429
            +    + + A N IG     +S  L    H     D  G +   HS   WV         
Sbjct: 2464 ETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASADLGGGKDATHSHP-WVG--WNDFAS 2634

Query: 430  XXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSL 488
                        ++   + R  QAF +V  R EPAV F +   + NR+     + T+   
Sbjct: 2635 PCLLAFLIMLQLKRANVQRRMAQAFQNV--REEPAVQFNSGTLALNRKAKNNPDPTI--Y 2802

Query: 489  GISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIA 548
             + D    K +DV+            G+G FG V +A++K+ DG  +  A+K +K +  +
Sbjct: 2803 PVLDWNDIKFQDVI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYAS 2940

Query: 549  SSDIEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
              D  +F  E   + K   HP++  L+G       +G L + +   P   HG+L  FL  
Sbjct: 2941 KDDHRDFAGELEVLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLGK 3102

Query: 608  SRIGENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDM 657
            SR+ E              L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+ 
Sbjct: 3103 SRVLETDPAFCHRQQYSSTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENY 3282

Query: 658  TVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMT 717
               +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++
Sbjct: 3283 IAKIADFGLSR---GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVS 3453

Query: 718  RGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
             G TPY G+  AE+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L 
Sbjct: 3454 LGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLN 3633

Query: 778  NILGHLSVLSTSQDPLYINIERAEQPTESG 807
             +L         +   Y+N    E+ T +G
Sbjct: 3634 RML--------EERKTYVNTTLYEKFTYAG 3699
>gb|BC006963.1|BC006963 Mus musculus, clone IMAGE:3708410, mRNA, partial cds
          Length = 1793

 Score =  197 bits (501), Expect = 4e-48
 Identities = 110/285 (38%), Positives = 161/285 (55%), Gaps = 8/285 (2%)
 Frame = +3

Query: 493 ELKEKLEDVLIPEQQFTLGRMLGKGEFGS------VREAQLKQEDGSFVKVAVKMLKADI 546
           E K K++D+ I  ++ TL  +L +G FG       V E    +E  +FVK        D 
Sbjct: 339 EAKAKVKDIAISRERITLKDVLQEGTFGRIFHGILVDEKDPNKEKQTFVKTV-----KDQ 503

Query: 547 IASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLL 606
            +   +   L E+  ++   H ++  +  V +    K     PMV+LP+M  G+L  FL 
Sbjct: 504 ASEVQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVVLPYMNWGNLKLFLR 668

Query: 607 ASRIGE--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADF 664
             ++ E  NP  +  Q LV   + IACGM YL+ R  IHRDLAARNC++ + + V + D 
Sbjct: 669 QCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHRDLAARNCVIDDTLQVKITDN 848

Query: 665 GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
            LSR ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY 
Sbjct: 849 ALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYV 1028

Query: 725 GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            I+  E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1029DIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1163
>gb|L02210.1|MUSYKINA Mus musculus tyrosine kinase-related protein mRNA, complete cds
          Length = 2463

 Score =  197 bits (501), Expect = 4e-48
 Identities = 110/285 (38%), Positives = 161/285 (55%), Gaps = 8/285 (2%)
 Frame = +1

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGS------VREAQLKQEDGSFVKVAVKMLKADI 546
            E K K++D+ I  ++ TL  +L +G FG       V E    +E  +FVK        D 
Sbjct: 1015 EAKAKVKDIAISRERITLKDVLQEGTFGRIFHGILVDEKDPNKEKQTFVKTV-----KDQ 1179

Query: 547  IASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLL 606
             +   +   L E+  ++   H ++  +  V +    K     PMV+LP+M  G+L  FL 
Sbjct: 1180 ASEVQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVVLPYMNWGNLKLFLR 1344

Query: 607  ASRIGE--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADF 664
              ++ E  NP  +  Q LV   + IACGM YL+ R  IHRDLAARNC++ + + V + D 
Sbjct: 1345 QCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHRDLAARNCVIDDTLQVKITDN 1524

Query: 665  GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
             LSR ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY 
Sbjct: 1525 ALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYV 1704

Query: 725  GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             I+  E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1705 DIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1839
>gb|L38394.1|MUSRYK Mus Musculus receptor tyrosine kinase-related protein (ryk2) mRNA,
            complete cds
          Length = 2092

 Score =  197 bits (501), Expect = 4e-48
 Identities = 110/285 (38%), Positives = 161/285 (55%), Gaps = 8/285 (2%)
 Frame = +3

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGS------VREAQLKQEDGSFVKVAVKMLKADI 546
            E K K++D+ I  ++ TL  +L +G FG       V E    +E  +FVK        D 
Sbjct: 963  EAKAKVKDIAISRERITLKDVLQEGTFGRIFHGILVDEKDPNKEKQTFVKTV-----KDQ 1127

Query: 547  IASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLL 606
             +   +   L E+  ++   H ++  +  V +    K     PMV+LP+M  G+L  FL 
Sbjct: 1128 ASEVQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVVLPYMNWGNLKLFLR 1292

Query: 607  ASRIGE--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADF 664
              ++ E  NP  +  Q LV   + IACGM YL+ R  IHRDLAARNC++ + + V + D 
Sbjct: 1293 QCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHRDLAARNCVIDDTLQVKITDN 1472

Query: 665  GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
             LSR ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY 
Sbjct: 1473 ALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYV 1652

Query: 725  GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             I+  E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1653 DIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1787
>ref|NM_011587.1| Mus musculus tyrosine kinase receptor 1 (Tie1), mRNA
          Length = 4092

 Score =  197 bits (501), Expect = 4e-48
 Identities = 169/539 (31%), Positives = 250/539 (46%), Gaps = 30/539 (5%)
 Frame = +2

Query: 272  TCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-IRTDSGL 328
            T LL  L P T+Y L VR  +   LGP+     V     G     AP++ HA   +DS +
Sbjct: 2156 TALLTGLTPGTHYQLDVRLYHCTLLGPASPPAHVHLPPSG---PPAPRHLHAQALSDSEI 2326

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTD-----WDPQKDLILR 383
             L W+   PE P  GP+  Y +      G+ D   ++  R   T       +     + R
Sbjct: 2327 QLMWQH--PEAPS-GPISKYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFR 2497

Query: 384  VCASNAIGDGPWSQPLVVSSHDHAGRQGPP--HSRTSW--------VPVVLGVXXXXXXX 433
            V AS   G G WS  +  ++  +  +   P   SR +         + VV  V       
Sbjct: 2498 VRAS-VQGLGDWSNTVEEATLGNGLQSEDPVRESRAAEEGLDQQLVLAVVGSVSATCLTI 2674

Query: 434  XXXXXXXXRKRRKETRFGQAFDSVMARGEPAV-HFRAARSFNRERPERIEATLDSLGISD 492
                      RR      + F      GE  +  F +       RP+             
Sbjct: 2675 LAALLALVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPK------------- 2815

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
               E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +  + +D 
Sbjct: 2816 PQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-EYASENDH 2989

Query: 553  EEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
             +F  E   + K   HP++  L+G       +G L I +   P+   G+L  FL  SR+ 
Sbjct: 2990 RDFAGELEVLCKLGHHPNIINLLGAC---ENRGYLYIAIEYAPY---GNLLDFLRKSRVL 3151

Query: 612  ENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCV 661
            E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ E++   +
Sbjct: 3152 ETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKI 3331

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
            ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WEI++ G T
Sbjct: 3332 ADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGT 3502

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            PY G+  AE+Y  L  G R++QP  C +EVY+LM QCW   P +RP F  + ++L  +L
Sbjct: 3503 PYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRML 3679
>emb|X80764.1|MMTIE1 M.musculus TIE1 mRNA
          Length = 4092

 Score =  197 bits (501), Expect = 4e-48
 Identities = 169/539 (31%), Positives = 250/539 (46%), Gaps = 30/539 (5%)
 Frame = +2

Query: 272  TCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-IRTDSGL 328
            T LL  L P T+Y L VR  +   LGP+     V     G     AP++ HA   +DS +
Sbjct: 2156 TALLTGLTPGTHYQLDVRLYHCTLLGPASPPAHVHLPPSG---PPAPRHLHAQALSDSEI 2326

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTD-----WDPQKDLILR 383
             L W+   PE P  GP+  Y +      G+ D   ++  R   T       +     + R
Sbjct: 2327 QLMWQH--PEAPS-GPISKYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFR 2497

Query: 384  VCASNAIGDGPWSQPLVVSSHDHAGRQGPP--HSRTSW--------VPVVLGVXXXXXXX 433
            V AS   G G WS  +  ++  +  +   P   SR +         + VV  V       
Sbjct: 2498 VRAS-VQGLGDWSNTVEEATLGNGLQSEDPVRESRAAEEGLDQQLVLAVVGSVSATCLTI 2674

Query: 434  XXXXXXXXRKRRKETRFGQAFDSVMARGEPAV-HFRAARSFNRERPERIEATLDSLGISD 492
                      RR      + F      GE  +  F +       RP+             
Sbjct: 2675 LAALLALVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPK------------- 2815

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
               E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +  + +D 
Sbjct: 2816 PQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-EYASENDH 2989

Query: 553  EEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
             +F  E   + K   HP++  L+G       +G L I +   P+   G+L  FL  SR+ 
Sbjct: 2990 RDFAGELEVLCKLGHHPNIINLLGAC---ENRGYLYIAIEYAPY---GNLLDFLRKSRVL 3151

Query: 612  ENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCV 661
            E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ E++   +
Sbjct: 3152 ETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKI 3331

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
            ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WEI++ G T
Sbjct: 3332 ADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGT 3502

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            PY G+  AE+Y  L  G R++QP  C +EVY+LM QCW   P +RP F  + ++L  +L
Sbjct: 3503 PYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRML 3679
>emb|X71425.1|MMTIE1A M.musculus Tie 1 mRNA
          Length = 3734

 Score =  197 bits (501), Expect = 4e-48
 Identities = 169/539 (31%), Positives = 250/539 (46%), Gaps = 30/539 (5%)
 Frame = +1

Query: 272  TCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-IRTDSGL 328
            T LL  L P T+Y L VR  +   LGP+     V     G     AP++ HA   +DS +
Sbjct: 1843 TALLTGLTPGTHYQLDVRLYHCTLLGPASPPAHVHLPPSG---PPAPRHLHAQALSDSEI 2013

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTD-----WDPQKDLILR 383
             L W+   PE P  GP+  Y +      G+ D   ++  R   T       +     + R
Sbjct: 2014 QLMWQH--PEAPS-GPISKYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFR 2184

Query: 384  VCASNAIGDGPWSQPLVVSSHDHAGRQGPP--HSRTSW--------VPVVLGVXXXXXXX 433
            V AS   G G WS  +  ++  +  +   P   SR +         + VV  V       
Sbjct: 2185 VRAS-VQGLGDWSNTVEEATLGNGLQSEDPVRESRAAEEGLDQQLVLAVVGSVSATCLTI 2361

Query: 434  XXXXXXXXRKRRKETRFGQAFDSVMARGEPAV-HFRAARSFNRERPERIEATLDSLGISD 492
                      RR      + F      GE  +  F +       RP+             
Sbjct: 2362 LAALLALVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPK------------- 2502

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
               E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +  + +D 
Sbjct: 2503 PQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-EYASENDH 2676

Query: 553  EEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
             +F  E   + K   HP++  L+G       +G L I +   P+   G+L  FL  SR+ 
Sbjct: 2677 RDFAGELEVLCKLGHHPNIINLLGAC---ENRGYLYIAIEYAPY---GNLLDFLRKSRVL 2838

Query: 612  ENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCV 661
            E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ E++   +
Sbjct: 2839 ETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKI 3018

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
            ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WEI++ G T
Sbjct: 3019 ADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGT 3189

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            PY G+  AE+Y  L  G R++QP  C +EVY+LM QCW   P +RP F  + ++L  +L
Sbjct: 3190 PYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRML 3366
>emb|X73960.1|MMTIERTK M.musculus mRNA for TIE receptor tyrosine kinase
          Length = 3790

 Score =  197 bits (501), Expect = 4e-48
 Identities = 169/539 (31%), Positives = 250/539 (46%), Gaps = 30/539 (5%)
 Frame = +3

Query: 272  TCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-IRTDSGL 328
            T LL  L P T+Y L VR  +   LGP+     V     G     AP++ HA   +DS +
Sbjct: 1842 TALLTGLTPGTHYQLDVRLYHCTLLGPASPPAHVHLPPSG---PPAPRHLHAQALSDSEI 2012

Query: 329  ILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTD-----WDPQKDLILR 383
             L W+   PE P  GP+  Y +      G+ D   ++  R   T       +     + R
Sbjct: 2013 QLMWQH--PEAPS-GPISKYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFR 2183

Query: 384  VCASNAIGDGPWSQPLVVSSHDHAGRQGPP--HSRTSW--------VPVVLGVXXXXXXX 433
            V AS   G G WS  +  ++  +  +   P   SR +         + VV  V       
Sbjct: 2184 VRAS-VQGLGDWSNTVEEATLGNGLQSEDPVRESRAAEEGLDQQLVLAVVGSVSATCLTI 2360

Query: 434  XXXXXXXXRKRRKETRFGQAFDSVMARGEPAV-HFRAARSFNRERPERIEATLDSLGISD 492
                      RR      + F      GE  +  F +       RP+             
Sbjct: 2361 LAALLALVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPK------------- 2501

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
               E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +  + +D 
Sbjct: 2502 PQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-EYASENDH 2675

Query: 553  EEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
             +F  E   + K   HP++  L+G       +G L I +   P+   G+L  FL  SR+ 
Sbjct: 2676 RDFAGELEVLCKLGHHPNIINLLGAC---ENRGYLYIAIEYAPY---GNLLDFLRKSRVL 2837

Query: 612  ENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCV 661
            E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ E++   +
Sbjct: 2838 ETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKI 3017

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
            ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WEI++ G T
Sbjct: 3018 ADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGT 3188

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            PY G+  AE+Y  L  G R++QP  C +EVY+LM QCW   P +RP F  + ++L  +L
Sbjct: 3189 PYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRML 3365
>ref|NM_002958.1| Homo sapiens RYK receptor-like tyrosine kinase (RYK), mRNA
          Length = 3031

 Score =  197 bits (500), Expect = 5e-48
 Identities = 109/280 (38%), Positives = 160/280 (56%), Gaps = 3/280 (1%)
 Frame = +2

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE-DGSFVKVAVKMLKADIIASSD 551
            E K K++D+ I  ++ TL  +L +G FG +    L  E D +  K A      D  +   
Sbjct: 1037 EAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQ 1216

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            +   L E+  ++   H ++  +  V +    K     PMVILP+M  G+L  FL   ++ 
Sbjct: 1217 VTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVILPYMNWGNLKLFLRQCKLV 1381

Query: 612  E--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
            E  NP  +  Q LV   + IACGM YL+ R  IH+DLAARNC++ + + V + D  LSR 
Sbjct: 1382 EANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRD 1561

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
            ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY  I+  
Sbjct: 1562 LFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPF 1741

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1742 EMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1861
>gb|M98547.1|MUSRTKRP Mouse growth factor receptor (RYK) mRNA, complete cds
          Length = 2065

 Score =  197 bits (500), Expect = 5e-48
 Identities = 110/285 (38%), Positives = 162/285 (56%), Gaps = 8/285 (2%)
 Frame = +2

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGS------VREAQLKQEDGSFVKVAVKMLKADI 546
            E K K++D+ I  ++ TL  +L +G FG       V E +  +E  +FVK        D 
Sbjct: 1004 EAKAKVKDIGISRERITLKDVLQEGSFGRIFHGILVDEKRPNKEKQTFVKTV-----KDQ 1168

Query: 547  IASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLL 606
             +   +   L E+  ++   H ++  +  V +    K     PMV+LP+M  G+L  FL 
Sbjct: 1169 ASEVQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVVLPYMNWGNLKLFLR 1333

Query: 607  ASRIGE--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADF 664
              ++ E  NP  +  Q LV   + IACGM YL+ R  IHRDLAARNC++ + + V + D 
Sbjct: 1334 QCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHRDLAARNCVIDDTLQVKITDN 1513

Query: 665  GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
             LSR ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY 
Sbjct: 1514 ALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYV 1693

Query: 725  GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             I+  E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1694 DIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1828
>gb|BC021700.1|BC021700 Homo sapiens, clone IMAGE:4052080, mRNA, partial cds
          Length = 1807

 Score =  197 bits (500), Expect = 5e-48
 Identities = 109/280 (38%), Positives = 160/280 (56%), Gaps = 3/280 (1%)
 Frame = +2

Query: 493 ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE-DGSFVKVAVKMLKADIIASSD 551
           E K K++D+ I  ++ TL  +L +G FG +    L  E D +  K A      D  +   
Sbjct: 338 EAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQ 517

Query: 552 IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
           +   L E+  ++   H ++  +  V +    K     PMVILP+M  G+L  FL   ++ 
Sbjct: 518 VTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVILPYMNWGNLKLFLRQCKLV 682

Query: 612 E--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
           E  NP  +  Q LV   + IACGM YL+ R  IH+DLAARNC++ + + V + D  LSR 
Sbjct: 683 EANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRD 862

Query: 670 IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
           ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY  I+  
Sbjct: 863 LFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPF 1042

Query: 730 EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
           E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1043EMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1162
>emb|X96588.1|HSHRYKG H.sapiens mRNA for H-RYK receptor tyrosine kinase
          Length = 2086

 Score =  197 bits (500), Expect = 5e-48
 Identities = 109/280 (38%), Positives = 160/280 (56%), Gaps = 3/280 (1%)
 Frame = +2

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE-DGSFVKVAVKMLKADIIASSD 551
            E K K++D+ I  ++ TL  +L +G FG +    L  E D +  K A      D  +   
Sbjct: 938  EAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKKKQAFVKTVKDQASEIQ 1117

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            +   L E+  ++   H ++  +  V +    K     PMVILP+M  G+L  FL   ++ 
Sbjct: 1118 VTMMLTESCKLRGLHHRNLLPITHVCIEEGEK-----PMVILPYMNWGNLKLFLRQCKLV 1282

Query: 612  E--NPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
            E  NP  +  Q LV   + IACGM YL+ R  IH+DLAARNC++ + + V + D  LSR 
Sbjct: 1283 EANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRD 1462

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
            ++  DY+  G     PV+W+ALESL +N ++  SDVWAFGVT+WE+MT GQTPY  I+  
Sbjct: 1463 LFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPF 1642

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
            E+  YL  G R+ QP  C +E++ +M  CW+ DP++RP F
Sbjct: 1643 EMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKF 1762
>emb|X71426.1|MMTIE2A M.musculus Tie 2 mRNA
          Length = 3490

 Score =  196 bits (499), Expect = 7e-48
 Identities = 168/566 (29%), Positives = 261/566 (45%), Gaps = 22/566 (3%)
 Frame = +3

Query: 264  VVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVP----FQTKGLAPARAPQNF 319
            + VP    + LL NL P   Y++R R    +     G+W      +    + P + P+N 
Sbjct: 1854 IKVPGNLTSVLLSNLVPREQYTVRAR----VNTKAQGEWSEELRAWTLSDILPPQ-PENI 2018

Query: 320  HAIR-TDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGT--RANLTDWDP 376
                 TDS  ++ W  ++        +  YK+    E+   D  +   T  +  L   +P
Sbjct: 2019 KISNITDSTAMVSWT-IVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEP 2195

Query: 377  QKDLILRVCASNAIGDG--PWSQPLVVSSHDHAGRQ-GPPHSRTSWVPVVLGVXXXXXXX 433
            +    + + A N IG     +S  L    H  A    G        +    G+       
Sbjct: 2196 ETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASADLGGGKMLLIAILGSAGMTCITVLL 2375

Query: 434  XXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGISD 492
                    ++   + R  QAF +   R EPAV F +   + NR+     + T+    + D
Sbjct: 2376 AFLIMLQLKRANVQRRMAQAFQN---REEPAVQFNSGTLALNRKAKNNPDPTI--YPVLD 2540

Query: 493  ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDI 552
                K +DV+            G+G FG V +A++K+ DG  +  A+K +K +  +  D 
Sbjct: 2541 WNDIKFQDVI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDDH 2678

Query: 553  EEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
             +F  E   + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+ 
Sbjct: 2679 RDFAGELEVLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRVL 2840

Query: 612  ENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCV 661
            E              L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    +
Sbjct: 2841 ETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKI 3020

Query: 662  ADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQT 721
            ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G T
Sbjct: 3021 ADFGLSR---GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGT 3191

Query: 722  PYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILG 781
            PY G+  AE+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L 
Sbjct: 3192 PYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML- 3368

Query: 782  HLSVLSTSQDPLYINIERAEQPTESG 807
                    +   Y+N    E+ T +G
Sbjct: 3369 -------EERKTYVNTTLYEKFTYAG 3425
>emb|X71423.1|BTTIE1A B.taurus Tie 1 mRNA
          Length = 3631

 Score =  196 bits (498), Expect = 9e-48
 Identities = 211/783 (26%), Positives = 328/783 (40%), Gaps = 53/783 (6%)
 Frame = +2

Query: 51   KLNCSVEGMEDPDIHWMK----DGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYW 106
            ++NC+  G   P    M+    DGTV+ +   +   +          +  +   D+GL+ 
Sbjct: 1142 RINCAAAGNPFPVRGSMELRKPDGTVLLSTKAI---VEPDRTTAEFEVPRLALGDSGLWE 1312

Query: 107  CQVK-DGEETKISQSVWLTVEGVPF-----FTVEPKDLAVPPNAPFQ-----LSCEAVGP 155
            C+V   G +      + + V  VP         + + L V P   F       S      
Sbjct: 1313 CRVSTSGGQDSRRFRINVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSGDGPIASVRLHYR 1492

Query: 156  PEPVTIYWWRGLTKVGGPAPSPSVLNV---TGVTQRTEFSCEARNIKGLATSRPAIVRLQ 212
            P+  T+ W    T V  P+ + +++N+   TG + R + S      +G A   P ++   
Sbjct: 1493 PQDSTMAW---STIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEG-AWGPPTLMTTD 1660

Query: 213  APPAA--PFNTTVTTISSYNASVAW-VPGADGLALLHSCTVQVAHAPGEWEALAVVVPVP 269
             P     P+             V+W +P   G  +     +++       E    V    
Sbjct: 1661 CPEPLLKPWLEGWHVEGPDRLRVSWSLPPVPGPLVGDGFLLRLWDGARGQERRENVSSPQ 1840

Query: 270  PFTCLLRNLAPATNYSLRVRCANA--LGPSPYGDWVPFQTKGLAPARAPQNFHA-IRTDS 326
              T LL  L P T Y L VR  +   LGP+     V     G     AP++ HA   +DS
Sbjct: 1841 ARTALLTGLTPGTYYQLDVRLYHCTLLGPASPAARVLLPPSG---PPAPRHLHAQALSDS 2011

Query: 327  GLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDW-----DPQKDLI 381
             + L W+     +   GP+  Y +      G+ D L ++  R   T       +     +
Sbjct: 2012 EIQLMWQR---PEAAAGPISKYIVEVQVAGGSGDPLWMDVDRPEETSTIVRGLNASTRYL 2182

Query: 382  LRVCASNAIGDGPWSQPLVVSS------------HDHAGRQGPPHSRTSWVPVVLGVXXX 429
             RV AS   G G WS  +  S+              HA  +G        + VV  V   
Sbjct: 2183 FRVRAS-VQGPGDWSNVVEQSTLGNGLQIEGPVQEIHAAEEGLDQQLV--LAVVGSVSAT 2353

Query: 430  XXXXXXXXXXXXRKRRKETRFGQAFDSVMARGEPAV-HFRAARSFNRERPERIEATLDSL 488
                          R+      + F      GE  +  F +       RP+         
Sbjct: 2354 CLTILAALLTLACIRKSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPK--------- 2506

Query: 489  GISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIA 548
                   E L   ++  +  T   ++G+G FG V  A +K+ DG  +  A+KMLK +  +
Sbjct: 2507 ----PQPEPLNYPVLEWEDITFEDLIGEGNFGQVIRAMIKK-DGLKMNAAIKMLK-EYAS 2668

Query: 549  SSDIEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
             +D  +F  E   + K   HP++  L+G       +G L I +   P+   G+L  FL  
Sbjct: 2669 ENDHRDFAGELEVLCKLGHHPNIINLLGAC---ENRGYLYIAIEYAPY---GNLLDFLRK 2830

Query: 608  SRIGENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDM 657
            SR+ E              L  + L+RF  D A GM+YLS + FIHRDLAARN ++ E++
Sbjct: 2831 SRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENL 3010

Query: 658  TVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMT 717
               +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT  SDVW+FGV +WEI++
Sbjct: 3011 ASKIADFGLSR---GEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVS 3181

Query: 718  RGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELE 777
             G TPY G+  AE+Y  L    R++QP  C +EVY+LM QCW   P +RP F  + ++L 
Sbjct: 3182 LGGTPYCGMTCAELYEKLPQAYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLG 3361

Query: 778  NIL 780
             +L
Sbjct: 3362 RML 3370
>gb|AF062496.1|AF062496 Oncorhynchus mykiss insulin receptor a (IRa) mRNA, partial cds
          Length = 3075

 Score =  196 bits (498), Expect = 9e-48
 Identities = 110/283 (38%), Positives = 161/283 (56%), Gaps = 13/283 (4%)
 Frame = +1

Query: 500  DVLIPE------QQFTLGRMLGKGEFGSVREAQLKQ--EDGSFVKVAVKMLKADIIASSD 551
            DV IP+      ++  + + LG+G FG V E   K   +     +VAVK +         
Sbjct: 1942 DVYIPDDWEVAREKINILKELGQGSFGMVYEGVAKDIVKGEPDTRVAVKTVNESASLRER 2121

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            IE FL EA+ MK F   HV +L+GV  + +        +V++  M HGDL +FL A R  
Sbjct: 2122 IE-FLNEASVMKGFSCHHVVRLLGVVSKGQPT------LVVMELMTHGDLKSFLRALRPD 2280

Query: 612  E--NPFNLPL---QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGL 666
               NP   PL   + +++   +IA GM YL+++ F+HRDLAARNCM+AED TV +  FG+
Sbjct: 2281 SESNPQGSPLPHLKEMIQMSGEIADGMAYLNAKKFVHRDLAARNCMVAEDNTVKIGYFGM 2460

Query: 667  SRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGI 726
            +R IY  DYYR+G    LPV  +A  SL D   T +SD W+FGV +WE+ T  + PY G+
Sbjct: 2461 TRDIYETDYYRKGGKGLLPVSGMASRSLKDGSVTAYSDCWSFGVVLWEVSTLAEQPYQGL 2640

Query: 727  ENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSF 769
             N ++  +++ G  L +P  C + +++LM  CW  +PK RP+F
Sbjct: 2641 SNEQVLKFVMDGGYLDRPENCEQRIHNLMSMCWQYNPKMRPTF 2769
>gb|L33920.1|XELFAK Xenopus laevis (clones 16, 5p, and 3p) focal adhesion kinase (FAK)
            mRNA, complete cds
          Length = 3943

 Score =  196 bits (497), Expect = 1e-47
 Identities = 103/281 (36%), Positives = 160/281 (56%)
 Frame = +1

Query: 500  DVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            D  I   +  LG  +G+G+FG V +      +   + VA+K  K +  + S  E+FL+EA
Sbjct: 1447 DYEIQRDRIELGPCIGEGQFGDVHQGVYMSPENPAMAVAIKTCK-NCTSDSVREKFLQEA 1623

Query: 560  ACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPL 619
              M++FDHPH+ KL+GV   +      P+  +I+     G+L +FL   +     ++L L
Sbjct: 1624 LTMRQFDHPHIVKLIGVITEN------PV-WIIMELCTLGELRSFLQVRK-----YSLDL 1767

Query: 620  QTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQG 679
             +L+ +   ++  + YL S+ F+HRD+AARN +++    V + DFGLSR +    YY+  
Sbjct: 1768 ASLILYSYQLSTALAYLESKRFVHRDIAARNVLVSSSDCVKLGDFGLSRYMEDSTYYKAS 1947

Query: 680  CASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGN 739
               KLP+KW+A ES+    +T  SDVW FGV MWEI+  G  P+ G++N ++   +  G 
Sbjct: 1948 -KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGVKPFQGVKNNDVIGRIENGE 2124

Query: 740  RLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            RL  PP C   +Y LM +CW+ DP +RP FT L+ +L  IL
Sbjct: 2125 RLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL 2247
>dbj|AB006559.3|AB006559 Ephydatia fluviatilis EfPTK13 mRNA for protein tyrosine kinase,
            complete cds
          Length = 6341

 Score =  196 bits (497), Expect = 1e-47
 Identities = 113/307 (36%), Positives = 167/307 (53%), Gaps = 6/307 (1%)
 Frame = +3

Query: 491  SDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSF---VKVAVKMLKADII 547
            +DE  E L+    P     L   + +GEFG V +       G     + VAVK L+   I
Sbjct: 5103 TDEDLELLQK--FPRGNLKLENFIDRGEFGEVFQGTATDILGPGTGPIPVAVKTLRKGAI 5276

Query: 548  ASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLA 607
                 ++FL EAA M  F+HP++ K++GV + +      P+  +I+  M  GDL  FL  
Sbjct: 5277 IEEQ-KKFLAEAALMGNFNHPNIVKVLGVCVEND-----PV-YIIMELMPGGDLLHFLRD 5435

Query: 608  SRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAE---DMTVCVADF 664
            +++   P  L ++ L++  +D+A G  YL   +FIHRDLAARNC+++    D  V + DF
Sbjct: 5436 AKVERGPPLLTVKELIQIALDVAQGCHYLQQTHFIHRDLAARNCLVSSKGADRVVKIGDF 5615

Query: 665  GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYA 724
            GL++ +YS DYY+     KLPV+W+A E+L    + + SDVW+FGV MWEIMT G  PY 
Sbjct: 5616 GLAKDLYSSDYYQVEGQRKLPVRWMAPEALLQGKFNMESDVWSFGVLMWEIMTFGNQPYP 5795

Query: 725  GIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLS 784
             + N E+  ++    RL++P  C  ++Y LM  CW     +R  F  ++  L N L HL 
Sbjct: 5796 ALNNQEVLQFVTAEGRLQKPENCPGKIYQLMQNCWKKVASERLHFDVIKEILNNYLEHLR 5975

Query: 785  VLSTSQD 791
              S S D
Sbjct: 5976 RDSVSSD 5996
>gb|U23839.1|DRU23839 Danio rerio fibroblast growth factor receptor 4 mRNA, complete cds
          Length = 4705

 Score =  196 bits (497), Expect = 1e-47
 Identities = 116/296 (39%), Positives = 164/296 (55%), Gaps = 15/296 (5%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREAQL----KQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            P +  TLG+ LG+G FG V  A+     K+       VAVKMLK D     D+ + + E 
Sbjct: 2122 PRENLTLGKPLGEGCFGQVVRAEAYGINKENQDHMATVAVKMLKDDA-TDKDLADLISEM 2298

Query: 560  ACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFN-- 616
              MK  D H ++  L+GV  +    G L    V++ +   G L  +L A R     +   
Sbjct: 2299 ELMKVMDKHKNIINLLGVCTQD---GPL---YVLVEYASKGSLREYLRARRPPGMDYTFD 2460

Query: 617  --------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSR 668
                    L  + LV     +A GMEYL+S+  IHRDLAARN ++ ED  + +ADFGL+R
Sbjct: 2461 VTKVPEEQLTFKDLVSCAYQVARGMEYLASKRCIHRDLAARNVLVTEDNVMKIADFGLAR 2640

Query: 669  KIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN 728
             ++  DYY++    ++PVKW+A E+L D +YT  SDVW+FGV MWEI T G +PY GI  
Sbjct: 2641 GVHQIDYYKKTTNGRMPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPV 2820

Query: 729  AEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLS 784
             E++  L  G+R+ +P  C  E+Y  M +CW A P QRP+F  L  EL+ +L  +S
Sbjct: 2821 EELFKLLKEGHRMDKPSNCTHELYMKMRECWHAVPTQRPTFKQLVEELDRVLVSIS 2988
>ref|NM_008000.1| Mus musculus fer (fms/fps related) protein kinase, testis specific 2
            (Fert2), mRNA
          Length = 2069

 Score =  195 bits (496), Expect = 1e-47
 Identities = 107/275 (38%), Positives = 159/275 (56%)
 Frame = +2

Query: 502  LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAAC 561
            ++  +  +LG +LGKG FG V +  LK +      VA+K  K D+     I+ FL+EA  
Sbjct: 1088 VLNHEDVSLGELLGKGNFGEVYKGTLKDK----TPVAIKTCKEDLPQELKIK-FLQEAKI 1252

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQT 621
            +K++DHP++ KL+GV  +     R P+  +I+  +  GD   FL   +       L L+ 
Sbjct: 1253 LKQYDHPNIVKLIGVCTQ-----RQPV-YIIMELVPGGDFLTFLRKRKD-----ELKLKQ 1399

Query: 622  LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
            LVRF +D+A GM YL S+N IHRDLAARNC++ E+ T+ ++DFG+SR+   G Y   G  
Sbjct: 1400 LVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQEDGGVYSSSGL- 1576

Query: 682  SKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRL 741
             ++P+KW A E+L    Y+  SDVW+FG+ +WE  + G  PY G+ N +    +  G R+
Sbjct: 1577 KQIPIKWTAAEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRM 1756

Query: 742  KQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
              P  C EEV+ +M +CW   P+ RP F  L  EL
Sbjct: 1757 SAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKEL 1861
>gb|M32054.1|MUSFERT Mouse tyrosine kinase (ferT) mRNA, complete cds
          Length = 2069

 Score =  195 bits (496), Expect = 1e-47
 Identities = 107/275 (38%), Positives = 159/275 (56%)
 Frame = +2

Query: 502  LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAAC 561
            ++  +  +LG +LGKG FG V +  LK +      VA+K  K D+     I+ FL+EA  
Sbjct: 1088 VLNHEDVSLGELLGKGNFGEVYKGTLKDK----TPVAIKTCKEDLPQELKIK-FLQEAKI 1252

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQT 621
            +K++DHP++ KL+GV  +     R P+  +I+  +  GD   FL   +       L L+ 
Sbjct: 1253 LKQYDHPNIVKLIGVCTQ-----RQPV-YIIMELVPGGDFLTFLRKRKD-----ELKLKQ 1399

Query: 622  LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
            LVRF +D+A GM YL S+N IHRDLAARNC++ E+ T+ ++DFG+SR+   G Y   G  
Sbjct: 1400 LVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQEDGGVYSSSGL- 1576

Query: 682  SKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRL 741
             ++P+KW A E+L    Y+  SDVW+FG+ +WE  + G  PY G+ N +    +  G R+
Sbjct: 1577 KQIPIKWTAAEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRM 1756

Query: 742  KQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
              P  C EEV+ +M +CW   P+ RP F  L  EL
Sbjct: 1757 SAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKEL 1861
>gb|S67051.1|S67051 tie2=cell surface receptor homolog [mice, lung, mRNA, 4364 nt]
          Length = 4364

 Score =  195 bits (496), Expect = 1e-47
 Identities = 167/567 (29%), Positives = 263/567 (45%), Gaps = 23/567 (4%)
 Frame = +1

Query: 264  VVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVP----FQTKGLAPARAPQNF 319
            + VP    + LL NL P   Y++R R    +     G+W      +    + P + P+N 
Sbjct: 1783 IKVPGNLTSVLLSNLVPREQYTVRAR----VNTKAQGEWSEELRAWTLSDILPPQ-PENI 1947

Query: 320  HAIR-TDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGT--RANLTDWDP 376
                 TDS  ++ W  ++        +  YK+    E+   D  +   T  +  L   +P
Sbjct: 1948 KISNITDSTAMVSWT-IVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEP 2124

Query: 377  QKDLILRVCASNAIGDG--PWSQPLVVSSHDHAGRQGPPHSRTSWVPVV--LGVXXXXXX 432
            +    + + A N IG     +S  L    H   G       +   + ++   G+      
Sbjct: 2125 ETTYHVDIFAENNIGSSNPAFSHELRTLPHS-PGSADLGGGKMLLIAILGSAGMTCITVL 2301

Query: 433  XXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGIS 491
                     ++   + R  QAF +   R EPAV F +   + NR+     + T+    + 
Sbjct: 2302 LAFLIMLQLKRANVQRRMAQAFQN---REEPAVQFNSGTLALNRKAKNNPDPTI--YPVL 2466

Query: 492  DELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSD 551
            D    K +DV+            G+G FG V +A++K+ DG  +  A+K +K +  +  D
Sbjct: 2467 DWNDIKFQDVI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDD 2604

Query: 552  IEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI 610
              +F  E   + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+
Sbjct: 2605 HRDFAGELEVLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRV 2766

Query: 611  GENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
             E              L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    
Sbjct: 2767 LETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAK 2946

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G 
Sbjct: 2947 IADFGLSR---GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGG 3117

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            TPY G+  AE+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L
Sbjct: 3118 TPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML 3297

Query: 781  GHLSVLSTSQDPLYINIERAEQPTESG 807
                     +   Y+N    E+ T +G
Sbjct: 3298 --------EERKTYVNTTLYEKFTYAG 3354
>dbj|AB007036.1|AB007036 Xenopus laevis mRNA for FGF receptor 4a, complete cds
          Length = 3004

 Score =  195 bits (496), Expect = 1e-47
 Identities = 121/296 (40%), Positives = 168/296 (55%), Gaps = 15/296 (5%)
 Frame = +3

Query: 504  PEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            P  +  LG+ LG+G FG V  A+     K      V VAVKMLK D     D+ + + E 
Sbjct: 1779 PRDRLVLGKPLGEGCFGQVVRAEGYGIEKDRPEKPVTVAVKMLK-DNGTDKDLSDLISEM 1955

Query: 560  ACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFN 616
              MK    H ++  L+GVS +   +G L    VI+ +   G+L  FL A R    E+ F+
Sbjct: 1956 ELMKVIGKHKNIINLLGVSTQ---EGPL---FVIVEYASKGNLREFLRARRPPTPEDAFD 2117

Query: 617  --------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSR 668
                    L  + LV     +A GMEYL S+  IHRDLAARN ++AED  + +ADFGL+R
Sbjct: 2118 ITKVPDELLSFKDLVSCAYQVARGMEYLESKRCIHRDLAARNVLVAEDNVMKIADFGLAR 2297

Query: 669  KIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN 728
             ++  DYY++    +LPVKW+A E+L D +YT  SD+W+FGV  WEI T G +PY GI  
Sbjct: 2298 GVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDIWSFGVLTWEIFTLGGSPYPGIPV 2477

Query: 729  AEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLS 784
             E++  L  G+R+ +P  C  E+Y LM +CW A P QRP+F  L  +L+ IL  +S
Sbjct: 2478 EELFKLLREGHRMDKPSNCTHELYMLMRECWHAVPSQRPTFKQLVEQLDRILTAVS 2645
 Score = 40.0 bits (92), Expect = 1.1
 Identities = 32/102 (31%), Positives = 41/102 (39%), Gaps = 13/102 (12%)
 Frame = +3

Query: 37   GAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMK------------DGTVVQNASQVSISIS 84
            G P   T   G  V+  C V     P I W+K            D   VQ      I+ S
Sbjct: 1152 GLPANTTARVGSDVEFYCKVYSDAQPHIQWLKHIEVNGSRFGPDDFPYVQVLKTADINTS 1331

Query: 85   EHSWIGLLSLKSVERSDAGLYWCQVKDGEETKIS-QSVWLTV 125
            E   + +L L+++   DAG Y C    G    +S QS WLTV
Sbjct: 1332 E---VEVLHLRNITMEDAGEYTCLA--GNSIGLSHQSAWLTV 1442
>dbj|D31761.1|XELFGFR4 Xenopus laevis mRNA for fibroblast growth factor receptor-4 (FGFR-4),
            complete cds
          Length = 2755

 Score =  195 bits (496), Expect = 1e-47
 Identities = 121/296 (40%), Positives = 168/296 (55%), Gaps = 15/296 (5%)
 Frame = +1

Query: 504  PEQQFTLGRMLGKGEFGSVREAQ----LKQEDGSFVKVAVKMLKADIIASSDIEEFLREA 559
            P  +  LG+ LG+G FG V  A+     K      V VAVKMLK D     D+ + + E 
Sbjct: 1444 PRDRLVLGKPLGEGCFGQVVRAEGYGIEKDRPEKPVTVAVKMLK-DNGTDKDLSDLISEM 1620

Query: 560  ACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--IGENPFN 616
              MK    H ++  L+GVS +   +G L    VI+ +   G+L  FL A R    E+ F+
Sbjct: 1621 ELMKVIGKHKNIINLLGVSTQ---EGPL---FVIVEYASKGNLREFLRARRPPTPEDAFD 1782

Query: 617  --------LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSR 668
                    L  + LV     +A GMEYL S+  IHRDLAARN ++AED  + +ADFGL+R
Sbjct: 1783 ITKVPDELLSFKDLVSCAYQVARGMEYLESKRCIHRDLAARNVLVAEDNVMKIADFGLAR 1962

Query: 669  KIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIEN 728
             ++  DYY++    +LPVKW+A E+L D +YT  SD+W+FGV  WEI T G +PY GI  
Sbjct: 1963 GVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDIWSFGVLTWEIFTLGGSPYPGIPV 2142

Query: 729  AEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLS 784
             E++  L  G+R+ +P  C  E+Y LM +CW A P QRP+F  L  +L+ IL  +S
Sbjct: 2143 EELFKLLREGHRMDKPSNCTHELYMLMRECWHAVPSQRPTFKQLVEQLDRILTAVS 2310
 Score = 40.0 bits (92), Expect = 1.1
 Identities = 32/102 (31%), Positives = 41/102 (39%), Gaps = 13/102 (12%)
 Frame = +1

Query: 37  GAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMK------------DGTVVQNASQVSISIS 84
           G P   T   G  V+  C V     P I W+K            D   VQ      I+ S
Sbjct: 817 GLPANTTARVGSDVEFYCKVYSDAQPHIQWLKHIEVNGSRFGPDDFPYVQVLKTADINTS 996

Query: 85  EHSWIGLLSLKSVERSDAGLYWCQVKDGEETKIS-QSVWLTV 125
           E   + +L L+++   DAG Y C    G    +S QS WLTV
Sbjct: 997 E---VEVLHLRNITMEDAGEYTCLA--GNSIGLSHQSAWLTV 1107
>emb|X67553.1|MMTEK M. musculus mRNA for tek
          Length = 4176

 Score =  195 bits (496), Expect = 1e-47
 Identities = 167/567 (29%), Positives = 263/567 (45%), Gaps = 23/567 (4%)
 Frame = +1

Query: 264  VVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVP----FQTKGLAPARAPQNF 319
            + VP    + LL NL P   Y++R R    +     G+W      +    + P + P+N 
Sbjct: 1891 IKVPGNLTSVLLSNLVPREQYTVRAR----VNTKAQGEWSEELRAWTLSDILPPQ-PENI 2055

Query: 320  HAIR-TDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGT--RANLTDWDP 376
                 TDS  ++ W  ++        +  YK+    E+   D  +   T  +  L   +P
Sbjct: 2056 KISNITDSTAMVSWT-IVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEP 2232

Query: 377  QKDLILRVCASNAIGDG--PWSQPLVVSSHDHAGRQGPPHSRTSWVPVV--LGVXXXXXX 432
            +    + + A N IG     +S  L    H   G       +   + ++   G+      
Sbjct: 2233 ETTYHVDIFAENNIGSSNPAFSHELRTLPHS-PGSADLGGGKMLLIAILGSAGMTCITVL 2409

Query: 433  XXXXXXXXXRKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGIS 491
                     ++   + R  QAF +   R EPAV F +   + NR+     + T+    + 
Sbjct: 2410 LAFLIMLQLKRANVQRRMAQAFQN---REEPAVQFNSGTLALNRKAKNNPDPTI--YPVL 2574

Query: 492  DELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSD 551
            D    K +DV+            G+G FG V +A++K+ DG  +  A+K +K +  +  D
Sbjct: 2575 DWNDIKFQDVI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDD 2712

Query: 552  IEEFLREAACM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI 610
              +F  E   + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+
Sbjct: 2713 HRDFAGELEVLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRV 2874

Query: 611  GENP----------FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC 660
             E              L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    
Sbjct: 2875 LETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAK 3054

Query: 661  VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ 720
            +ADFGLSR     + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G 
Sbjct: 3055 IADFGLSR---GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGG 3225

Query: 721  TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL 780
            TPY G+  AE+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L
Sbjct: 3226 TPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML 3405

Query: 781  GHLSVLSTSQDPLYINIERAEQPTESG 807
                     +   Y+N    E+ T +G
Sbjct: 3406 --------EERKTYVNTTLYEKFTYAG 3462
>gb|M91599.1|RATFGR4A Rat fibroblast growth factor receptor subtype 4 (FGFR4) mRNA,
            complete cds
          Length = 2648

 Score =  195 bits (495), Expect = 2e-47
 Identities = 123/327 (37%), Positives = 177/327 (53%), Gaps = 17/327 (5%)
 Frame = +2

Query: 504  PEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVK----VAVKMLKADIIASSDIEEFLREA 559
            P  +  LG+ LG+G FG V  A+    D S       VAVKMLK D  +  D+ + + E 
Sbjct: 1022 PRDRLVLGKPLGEGCFGQVVCAEALGMDSSRPDQTSIVAVKMLK-DNASDKDLADLISEM 1198

Query: 560  ACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASR--------- 609
              MK    H ++  L+GV  +   +G L    VI+ +   G+L  FL A R         
Sbjct: 1199 EMMKLIGRHKNIINLLGVCTQ---EGPL---YVIVEYAAKGNLREFLRARRPPGPDLSPD 1360

Query: 610  ---IGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGL 666
                 E P + P   LV     +A GM+YL SR  IHRDLAARN ++ ED  + +ADFGL
Sbjct: 1361 GPRSSEGPLSFP--ALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGL 1534

Query: 667  SRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGI 726
            +R ++  DYY++    +LPVKW+A E+L D +YT  SDVW+FG+ +WEI T G +PY GI
Sbjct: 1535 ARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGI 1714

Query: 727  ENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVL 786
               E+++ L  G+R+++PP C  E+Y LM +CW A P QRP+F  L   L+ +L     L
Sbjct: 1715 PVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVL-----L 1879

Query: 787  STSQDPLYINIERAEQPTESGSPELHC 813
            + S++ L + +        +G     C
Sbjct: 1880 AVSEEYLDLRLTFGPYSPNNGDASSTC 1960
 Score = 40.4 bits (93), Expect = 0.80
 Identities = 39/116 (33%), Positives = 48/116 (40%), Gaps = 13/116 (11%)
 Frame = +2

Query: 37  GAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMK-----------DG-TVVQNASQVSISIS 84
           G P   T   G  V+L C V     P I W+K           DG   VQ      I+ S
Sbjct: 389 GLPANTTAVVGSNVELLCKVYSDAQPHIQWLKHIVINGSSLGADGFPYVQVLKTTDINSS 568

Query: 85  EHSWIGLLSLKSVERSDAGLYWCQVKDGEETKIS-QSVWLTVEGVPFFTVEPKDLA 139
           E   + +L L++V   DAG Y C    G    +S QS WLTV        E +DLA
Sbjct: 569 E---VEVLYLRNVSAEDAGEYTCLA--GNSIGLSYQSAWLTV-----LPAEEEDLA 706
>gb|M64612.1|HYDTYRKINB Hydra vulgaris protein-tyrosine kinase (HTK7) mRNA, complete cds
          Length = 4897

 Score =  195 bits (495), Expect = 2e-47
 Identities = 110/287 (38%), Positives = 162/287 (56%), Gaps = 7/287 (2%)
 Frame = +3

Query: 499  EDVLIPEQ------QFTLGRMLGKGEFGSVREAQLKQ-EDGSFVKVAVKMLKADIIASSD 551
            ++V IP++      +  L R LG+G FG V E       D + ++VAVK    +      
Sbjct: 3189 KEVYIPDEWELNREKIELIRELGQGSFGMVFEGIAHGIGDHAELRVAVKTTNENASIHDR 3368

Query: 552  IEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIG 611
            I+  L+EA+ MK F+  HV KL+GV  + +         V++  M  GDL ++L   R  
Sbjct: 3369 IQ-ILQEASIMKAFNCNHVVKLIGVVSQGQPT------FVVMELMGRGDLKSYLKERRPD 3527

Query: 612  ENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIY 671
            +    L  Q + + + +IA GM YL++R F+H DLAARNCM+A D TV + DFG++R IY
Sbjct: 3528 DGGIPLMRQEIYQMVAEIADGMAYLAARKFVHCDLAARNCMVASDFTVKIGDFGMARDIY 3707

Query: 672  SGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEI 731
              +YYR+   S LP++W+A ESL D +++  SDVW+FGV +WEI T    PY G  N ++
Sbjct: 3708 ERNYYRKDGKSLLPIRWMAPESLKDGIFSTASDVWSFGVVLWEICTLASQPYQGKTNEQV 3887

Query: 732  YNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELEN 778
             N+++    L  P  C  ++ + M  CW  DPK RPSF  +   LEN
Sbjct: 3888 LNFVLSNGHLDYPEGCDYQLREFMSLCWHRDPKMRPSFLEIVHVLEN 4028
>gb|M37722.1|HUMBFGFS Human shorter form basic fibroblast growth factor (bFGF) receptor
            mRNA, complete cds
          Length = 3328

 Score =  195 bits (495), Expect = 2e-47
 Identities = 128/339 (37%), Positives = 189/339 (54%), Gaps = 18/339 (5%)
 Frame = +1

Query: 477  RPERIEATLDSL--GISD-ELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQL----KQ 529
            RP R+ ++   +  G+S+ EL E L   L P  +  LG+ LG+G FG V  A+     K 
Sbjct: 1288 RPSRLSSSGTPMLAGVSEYELPEDLRWEL-PRDRLVLGKPLGEGCFGQVVLAEAIGLDKD 1464

Query: 530  EDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFD-HPHVAKLVGVSLRSRAKGRLPI 588
            +     KVAVKMLK+D     D+ + + E   MK    H ++  L+G   +    G L  
Sbjct: 1465 KPNRVTKVAVKMLKSDA-TEKDLSDLISEMEMMKMIGKHKNIINLLGACTQD---GPL-- 1626

Query: 589  PMVILPFMKHGDLHAFLLASRI---------GENPFN-LPLQTLVRFMVDIACGMEYLSS 638
              VI+ +   G+L  +L A R            NP   L  + LV     +A GMEYL+S
Sbjct: 1627 -YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLAS 1803

Query: 639  RNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNL 698
            +  IHRDLAARN ++ ED  + +ADFGL+R I+  DYY++    +LPVKW+A E+L D +
Sbjct: 1804 KKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRI 1983

Query: 699  YTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQC 758
            YT  SDVW+FGV +WEI T G +PY G+   E++  L  G+R+ +P  C  E+Y +M  C
Sbjct: 1984 YTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDC 2163

Query: 759  WSADPKQRPSFTCLRMELENILGHLSVLSTSQDPLYINI 797
            W A P QRP+F  L  +L+ I+     L+++Q+ L +++
Sbjct: 2164 WHAVPSQRPTFKQLVEDLDRIV----ALTSNQEYLDLSM 2268
>ref|NM_000459.1| Homo sapiens TEK tyrosine kinase, endothelial (venous malformations,
            multiple cutaneous and mucosal) (TEK), mRNA
          Length = 4138

 Score =  195 bits (495), Expect = 2e-47
 Identities = 133/378 (35%), Positives = 200/378 (52%), Gaps = 12/378 (3%)
 Frame = +2

Query: 442  RKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGISDELKEKLED 500
            ++   + R  QAF +V  R EPAV F +   + NR+     + T+    + D    K +D
Sbjct: 2465 KRANVQRRMAQAFQNV--REEPAVQFNSGTLALNRKVKNNPDPTI--YPVLDWNDIKFQD 2632

Query: 501  VLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            V+            G+G FG V +A++K+ DG  +  A+K +K +  +  D  +F  E  
Sbjct: 2633 VI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDDHRDFAGELE 2770

Query: 561  CM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP----- 614
             + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+ E       
Sbjct: 2771 VLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRVLETDPAFAI 2932

Query: 615  -----FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
                   L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    +ADFGLSR 
Sbjct: 2933 ANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSR- 3109

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
                + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G TPY G+  A
Sbjct: 3110 --GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCA 3283

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTS 789
            E+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L         
Sbjct: 3284 ELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML--------E 3439

Query: 790  QDPLYINIERAEQPTESG 807
            +   Y+N    E+ T +G
Sbjct: 3440 ERKTYVNTTLYEKFTYAG 3493
>gb|L06139.1|HUMTEKRPTK Homo sapiens receptor protein-tyrosine kinase (TEK) mRNA, complete
            cds
          Length = 4138

 Score =  195 bits (495), Expect = 2e-47
 Identities = 133/378 (35%), Positives = 200/378 (52%), Gaps = 12/378 (3%)
 Frame = +2

Query: 442  RKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGISDELKEKLED 500
            ++   + R  QAF +V  R EPAV F +   + NR+     + T+    + D    K +D
Sbjct: 2465 KRANVQRRMAQAFQNV--REEPAVQFNSGTLALNRKVKNNPDPTI--YPVLDWNDIKFQD 2632

Query: 501  VLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            V+            G+G FG V +A++K+ DG  +  A+K +K +  +  D  +F  E  
Sbjct: 2633 VI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDDHRDFAGELE 2770

Query: 561  CM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP----- 614
             + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+ E       
Sbjct: 2771 VLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRVLETDPAFAI 2932

Query: 615  -----FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
                   L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    +ADFGLSR 
Sbjct: 2933 ANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSR- 3109

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
                + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G TPY G+  A
Sbjct: 3110 --GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCA 3283

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTS 789
            E+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L         
Sbjct: 3284 ELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML--------E 3439

Query: 790  QDPLYINIERAEQPTESG 807
            +   Y+N    E+ T +G
Sbjct: 3440 ERKTYVNTTLYEKFTYAG 3493
>ref|XM_005480.4| Homo sapiens TEK tyrosine kinase, endothelial (venous malformations,
            multiple cutaneous and mucosal) (TEK), mRNA
          Length = 3934

 Score =  195 bits (495), Expect = 2e-47
 Identities = 133/378 (35%), Positives = 200/378 (52%), Gaps = 12/378 (3%)
 Frame = +3

Query: 442  RKRRKETRFGQAFDSVMARGEPAVHFRAAR-SFNRERPERIEATLDSLGISDELKEKLED 500
            ++   + R  QAF +V  R EPAV F +   + NR+     + T+    + D    K +D
Sbjct: 2274 KRANVQRRMAQAFQNV--REEPAVQFNSGTLALNRKVKNNPDPTI--YPVLDWNDIKFQD 2441

Query: 501  VLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA 560
            V+            G+G FG V +A++K+ DG  +  A+K +K +  +  D  +F  E  
Sbjct: 2442 VI------------GEGNFGQVLKARIKK-DGLRMDAAIKRMK-EYASKDDHRDFAGELE 2579

Query: 561  CM-KEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP----- 614
             + K   HP++  L+G       +G L + +   P   HG+L  FL  SR+ E       
Sbjct: 2580 VLCKLGHHPNIINLLGAC---EHRGYLYLAIEYAP---HGNLLDFLRKSRVLETDPAFAI 2741

Query: 615  -----FNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRK 669
                   L  Q L+ F  D+A GM+YLS + FIHRDLAARN ++ E+    +ADFGLSR 
Sbjct: 2742 ANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSR- 2918

Query: 670  IYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENA 729
                + Y +    +LPV+W+A+ESL  ++YT +SDVW++GV +WEI++ G TPY G+  A
Sbjct: 2919 --GQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCA 3092

Query: 730  EIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLSTS 789
            E+Y  L  G RL++P  C +EVYDLM QCW   P +RPSF  + + L  +L         
Sbjct: 3093 ELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML--------E 3248

Query: 790  QDPLYINIERAEQPTESG 807
            +   Y+N    E+ T +G
Sbjct: 3249 ERKTYVNTTLYEKFTYAG 3302
>ref|NM_010206.1| Mus musculus fibroblast growth factor receptor 1 (Fgfr1), mRNA
          Length = 2526

 Score =  194 bits (494), Expect = 3e-47
 Identities = 119/310 (38%), Positives = 173/310 (55%), Gaps = 15/310 (4%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQL----KQEDGSFVKVAVKMLKADIIASSDIEEFLRE 558
            +P  +  LG+ LG+G FG V  A+     K +     KVAVKMLK+D     D+ + + E
Sbjct: 1474 LPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA-TEKDLSDLISE 1650

Query: 559  AACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI------- 610
               MK    H ++  L+G   +    G L    VI+ +   G+L  +L A R        
Sbjct: 1651 MEMMKMIGKHKNIINLLGACTQD---GPL---YVIVEYASKGNLREYLQARRPPGLEYCY 1812

Query: 611  --GENPFN-LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
                NP   L  + LV     +A GMEYL+S+  IHRDLAARN ++ ED  + +ADFGL+
Sbjct: 1813 NPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLA 1992

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R I+  DYY++    +LPVKW+A E+L D +YT  SDVW+FGV +WEI T G +PY G+ 
Sbjct: 1993 RDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVP 2172

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
              E++  L  G+R+ +P  C  E+Y +M  CW A P QRP+F     +L   L H+  L+
Sbjct: 2173 VEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTF----KQLVEDLDHIVALT 2340

Query: 788  TSQDPLYINI 797
            ++Q+ L ++I
Sbjct: 2341 SNQEYLDLSI 2370
>gb|U22324.1|MMU22324 Mus musculus fibroblast growth factor receptor-1 mRNA, long isoform
            precursor, complete cds
          Length = 2526

 Score =  194 bits (494), Expect = 3e-47
 Identities = 120/310 (38%), Positives = 174/310 (55%), Gaps = 15/310 (4%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQL----KQEDGSFVKVAVKMLKADIIASSDIEEFLRE 558
            +P  +  LG+ LG+G FG V  A+     K +     KVAVKMLK+D     D+ + + E
Sbjct: 1474 LPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA-TEKDLSDLISE 1650

Query: 559  AACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI------- 610
               MK    H ++  L+G   +    G L    VI+ +   G+L  +L A R        
Sbjct: 1651 MEMMKMIGKHKNIINLLGACTQD---GPL---YVIVEYASKGNLREYLQARRPPGLEYCY 1812

Query: 611  --GENPFN-LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
                NP   L  + LV     +A GMEYL+S+  IHRDLAARN ++ ED  + +ADFGL+
Sbjct: 1813 NPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLA 1992

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R I+  DYY++    +LPVKW+A E+L D +YT  SDVW+FGV +WEI T G +PY G+ 
Sbjct: 1993 RDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVP 2172

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
              E++  L  G+R+ +P  C  E+Y +M  CW A P QRP+F  L  +L+ I+     L+
Sbjct: 2173 VEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIV----ALT 2340

Query: 788  TSQDPLYINI 797
            +SQ+ L ++I
Sbjct: 2341 SSQEYLDLSI 2370
>gb|M28998.1|MUSBFGFR Mouse basic fibroblast growth factor receptor (bFGF-R) mRNA, complete
            cds
          Length = 2526

 Score =  194 bits (494), Expect = 3e-47
 Identities = 119/310 (38%), Positives = 173/310 (55%), Gaps = 15/310 (4%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQL----KQEDGSFVKVAVKMLKADIIASSDIEEFLRE 558
            +P  +  LG+ LG+G FG V  A+     K +     KVAVKMLK+D     D+ + + E
Sbjct: 1474 LPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA-TEKDLSDLISE 1650

Query: 559  AACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI------- 610
               MK    H ++  L+G   +    G L    VI+ +   G+L  +L A R        
Sbjct: 1651 MEMMKMIGKHKNIINLLGACTQD---GPL---YVIVEYASKGNLREYLQARRPPGLEYCY 1812

Query: 611  --GENPFN-LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
                NP   L  + LV     +A GMEYL+S+  IHRDLAARN ++ ED  + +ADFGL+
Sbjct: 1813 NPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLA 1992

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R I+  DYY++    +LPVKW+A E+L D +YT  SDVW+FGV +WEI T G +PY G+ 
Sbjct: 1993 RDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVP 2172

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
              E++  L  G+R+ +P  C  E+Y +M  CW A P QRP+F     +L   L H+  L+
Sbjct: 2173 VEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTF----KQLVEDLDHIVALT 2340

Query: 788  TSQDPLYINI 797
            ++Q+ L ++I
Sbjct: 2341 SNQEYLDLSI 2370
>gb|U76762.1|MMU76762 Mus musculus fps/fes-related tyrosine kinase mRNA, complete cds
          Length = 2994

 Score =  194 bits (494), Expect = 3e-47
 Identities = 107/275 (38%), Positives = 159/275 (56%)
 Frame = +2

Query: 502  LIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAAC 561
            ++  +  +LG +LGKG FG V +  LK +      VA+K  K D+     I+ FL+EA  
Sbjct: 1739 VLNHEDVSLGELLGKGNFGEVYKGTLKDK----TPVAIKTCKEDLPQELKIK-FLQEAKI 1903

Query: 562  MKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQT 621
            +K++DHP++ KL+GV  +     R P+  +I+  +  GD   FL   +       L L+ 
Sbjct: 1904 LKQYDHPNIVKLIGVCTQ-----RQPV-YIIMELVPGGDFLTFLRKRKD-----ELKLKQ 2050

Query: 622  LVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCA 681
            LVRF +D+A GM YL S+N IHRDLAARNC++ E+ T+ ++DFG+SR+   G Y   G  
Sbjct: 2051 LVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQEDGGVYSSSGL- 2227

Query: 682  SKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRL 741
             ++P+KW A E+L    Y+  SDVW+FG+ +WE  + G  PY G+ N +    +  G R+
Sbjct: 2228 KQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRM 2407

Query: 742  KQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMEL 776
              P  C EEV+ +M +CW   P+ RP F  L  EL
Sbjct: 2408 SAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKEL 2512
>gb|U23445.1|MMU23445 Mus musculus fibroblast growth factor receptor-1, short isoform
            precursor mRNA, complete cds
          Length = 2259

 Score =  194 bits (494), Expect = 3e-47
 Identities = 120/310 (38%), Positives = 174/310 (55%), Gaps = 15/310 (4%)
 Frame = +1

Query: 503  IPEQQFTLGRMLGKGEFGSVREAQL----KQEDGSFVKVAVKMLKADIIASSDIEEFLRE 558
            +P  +  LG+ LG+G FG V  A+     K +     KVAVKMLK+D     D+ + + E
Sbjct: 1207 LPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA-TEKDLSDLISE 1383

Query: 559  AACMKEFD-HPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRI------- 610
               MK    H ++  L+G   +    G L    VI+ +   G+L  +L A R        
Sbjct: 1384 MEMMKMIGKHKNIINLLGACTQD---GPL---YVIVEYASKGNLREYLQARRPPGLEYCY 1545

Query: 611  --GENPFN-LPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLS 667
                NP   L  + LV     +A GMEYL+S+  IHRDLAARN ++ ED  + +ADFGL+
Sbjct: 1546 NPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLA 1725

Query: 668  RKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIE 727
            R I+  DYY++    +LPVKW+A E+L D +YT  SDVW+FGV +WEI T G +PY G+ 
Sbjct: 1726 RDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVP 1905

Query: 728  NAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGHLSVLS 787
              E++  L  G+R+ +P  C  E+Y +M  CW A P QRP+F  L  +L+ I+     L+
Sbjct: 1906 VEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIV----ALT 2073

Query: 788  TSQDPLYINI 797
            +SQ+ L ++I
Sbjct: 2074 SSQEYLDLSI 2103
  Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS,
  or phase 0, 1 or 2 HTGS sequences)
    Posted date:  Feb 19, 2002 12:00 AM
  Number of letters in database: 587,334,133
  Number of sequences in database:  1,164,257
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 7.29e-304 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,333,635,318
Number of Sequences: 1164257
Number of extensions: 93156899
Number of successful extensions: 439864
Number of sequences better than 10.0: 9694
Number of HSP's better than 10.0 without gapping: 56377
Number of HSP's successfully gapped in prelim test: 24217
Number of HSP's that attempted gapping in prelim test: 286918
Number of HSP's gapped (non-prelim): 250746
length of query: 880
length of database: 1,627,433,809
effective HSP length: 144
effective length of query: 736
effective length of database: 1,459,780,801
effective search space: 1074398669536
effective search space used: 1074398669536
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 84 (37.0 bits)